SecReT4
Protein ID: 145301425
T4SS name [ID]Tra_F [130]
Gene symboltraD
Locus tagASA_P5G042
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]40743..42905 [+]
ProductTraD protein
Component typeTraD_F
UniProt IDA4SUE4
KEGG IDasa:ASA_P5G042
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 7.7e-151, Aligned region: 172..561
TraD_N [PF12615], Evalue: 5.6e-28, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 3.8e-18, Aligned region: 419..538
AAA_10 [PF12846], Evalue: 3.5e-16, Aligned region: 187..495
T4SS-DNA_transf [PF02534], Evalue: 1.5e-09, Aligned region: 384..509
Protein Sequence: 720 a.a.     [Download]
>gi|145301425|ref|YP_001144264.1| TraD protein [Aeromonas salmonicida subsp. salmonicida A449]
MSLNTRDVTQGGQVAFMRLRMFLQINNILSYWLILSFIVLTGSILFYRVSTQNLINGLMYWYATTIEPLH
KFMTNPPTYKIQYYERVLHYNTKQILSDAYTVYCGQLFKNELIIAALSSMIIVFVAGLLFYLYIGILGKK
QSEDEITGGRTLSDNPKKVARMMRRQKVASDIIVDDLPIIKDSEIQNFAMHGTVGSGKSTLMRKFLDQCR
QRGDMVIIYDKGCTFVEEYYQEGRDIILNPLDQRCANWDMWEECQTLPDLESAATTLIPMGSSEDPFWQG
SARTIFAEGAHRLRTEKGRSYNLFLRTLLAITLDKLREFLAGTPAANLVDGKIEKTAISIRSVLTNYVKA
MRYLQGIERKGKPFTIRQWMQGVRDGGENGWLFITSNQKHHESLKPLISMWLSIAANSLLSMGENRYRRV
WFFYDELPSLHKLPSLPFIIAEARKFGGCFALGFQSYSQLEEIYGNKFAEAMYDLLNTKYFFRSPSASVA
KFVEEDIGETVRKKFSEQTSFGADQVRDGISFGKDEERVNIVSYTDIQMLDNLDCFVTLPGNFPVVRMTL
KFVKKEKIAESLPERDIQSSLDPEVDDEITQRLNETGKIFDNVTPGVLPAVAAQAAATFSIVTHATAQPP
TPVTVPAQAVQATDTGTETATTQPPAGRDQELTMRDPRPAGVDENGVIYDEDLYAEYQKSAQTQQEAARR
EEVNINHHHQELGGDEPEFM
 
Nucleotide Sequence: 2163 bp     [Download]
>gi|145301385|ref|NC_009350.1|:40743-42905 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGAGCTTAAACACCCGCGATGTGACGCAGGGCGGGCAAGTCGCGTTTATGCGTCTGCGCATGTTCCTGC
AAATAAACAACATTCTATCCTATTGGCTTATTTTGTCCTTTATTGTCCTGACCGGGTCGATTTTATTTTA
TCGTGTCAGCACCCAAAACCTGATCAACGGTCTCATGTACTGGTATGCAACCACCATTGAACCGTTGCAT
AAATTCATGACCAATCCGCCGACCTACAAGATCCAATATTATGAGCGCGTCCTGCACTACAACACCAAGC
AGATATTGAGTGATGCCTACACGGTCTATTGCGGACAGCTATTCAAGAACGAACTCATTATTGCCGCTTT
ATCCTCGATGATCATCGTGTTTGTCGCTGGCCTGCTGTTCTATTTGTATATTGGTATATTGGGCAAAAAG
CAGAGTGAAGACGAGATAACCGGCGGGCGCACCCTGAGTGACAACCCGAAAAAAGTCGCCCGCATGATGC
GTCGCCAAAAAGTAGCCTCCGATATCATCGTGGATGATCTGCCCATTATCAAAGACAGCGAAATTCAGAA
CTTCGCCATGCATGGTACCGTGGGTTCGGGTAAATCGACGCTCATGCGCAAATTTCTCGACCAGTGCCGT
CAGCGCGGGGATATGGTCATTATTTATGACAAGGGCTGCACCTTTGTCGAAGAGTATTATCAGGAAGGCC
GCGACATCATCCTTAACCCCCTGGATCAACGCTGCGCCAACTGGGATATGTGGGAAGAGTGCCAGACCTT
GCCCGATCTCGAATCGGCAGCCACCACCCTTATTCCGATGGGCTCCTCGGAAGACCCCTTCTGGCAGGGC
TCGGCCCGCACTATCTTTGCCGAAGGTGCCCACCGCCTGCGCACTGAAAAAGGGCGCAGCTATAACTTGT
TCCTGCGCACCCTCCTGGCCATCACCCTCGATAAACTGCGCGAGTTTCTGGCAGGGACGCCCGCAGCCAA
CCTGGTTGACGGCAAGATAGAAAAAACCGCCATCTCTATTCGAAGCGTGTTGACCAACTACGTTAAGGCG
ATGCGCTATCTGCAGGGCATTGAGCGCAAAGGTAAACCCTTTACCATTCGCCAGTGGATGCAGGGCGTCC
GTGACGGTGGTGAAAATGGCTGGTTGTTCATCACCTCCAACCAAAAACACCACGAATCCCTCAAACCCTT
GATCTCGATGTGGCTCAGCATTGCCGCCAACAGCCTGCTATCAATGGGCGAAAACCGCTACCGGCGCGTG
TGGTTCTTCTATGACGAGCTGCCCTCCCTGCACAAGCTGCCGAGCCTGCCGTTCATCATCGCCGAGGCCC
GCAAGTTCGGCGGCTGTTTTGCGTTGGGCTTCCAGTCCTACTCGCAGCTCGAGGAGATTTACGGCAATAA
ATTTGCCGAGGCCATGTATGACCTGCTCAACACCAAGTATTTCTTTCGCTCCCCCTCTGCCTCCGTCGCC
AAATTTGTCGAGGAGGATATCGGCGAAACCGTGCGCAAGAAGTTCTCCGAGCAGACCAGTTTCGGTGCCG
ATCAGGTGCGTGACGGTATCTCGTTTGGCAAGGATGAGGAGCGCGTCAATATTGTCAGCTACACCGACAT
TCAGATGCTCGACAACCTGGACTGTTTCGTGACATTACCTGGCAACTTCCCGGTGGTGCGCATGACACTC
AAATTCGTGAAGAAGGAGAAAATTGCCGAGTCCCTGCCAGAGCGGGATATCCAGTCCAGCCTGGATCCCG
AAGTGGACGACGAGATCACCCAGCGTCTCAACGAGACTGGCAAGATCTTCGACAACGTCACCCCCGGCGT
ACTCCCTGCGGTTGCCGCCCAGGCAGCAGCCACCTTTTCGATAGTGACCCACGCCACCGCGCAGCCCCCA
ACCCCAGTGACCGTGCCCGCTCAGGCGGTTCAAGCAACGGACACCGGCACCGAGACGGCGACAACGCAAC
CACCTGCCGGTCGTGACCAGGAGCTCACCATGCGCGACCCCCGACCTGCAGGCGTCGATGAAAACGGGGT
GATTTACGACGAGGATCTCTACGCCGAGTACCAGAAATCCGCACAGACGCAGCAAGAAGCAGCGCGACGC
GAAGAGGTCAACATTAACCATCACCATCAAGAGCTGGGTGGTGACGAGCCGGAGTTTATGTAA
 Primer design