SecReT4
Protein ID: 145301426
T4SS name [ID]Tra_F [130]
Gene symboltraI
Locus tagASA_P5G043
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]42906..48068 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDA4SUE5
KEGG IDasa:ASA_P5G043
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.9e-77, Aligned region: 5..296
TraI [PF07057], Evalue: 2.5e-51, Aligned region: 1408..1535
AAA_30 [PF13604], Evalue: 1.1e-42, Aligned region: 962..1146
AAA_19 [PF13245], Evalue: 5.3e-05, Aligned region: 978..1040
Protein Sequence: 1720 a.a.     [Download]
>gi|145301426|ref|YP_001144265.1| TraI protein [Aeromonas salmonicida subsp. salmonicida A449]
MLSLSTIKGSAAYYAAEENYYAMGELESVWMGEGADRLGLSGPIDGADRLGLSGPIDGATLDAIAQGKLP
DGTELSRIVDGKQTHRTGYDLTFSAPKSVSVMALVAGDERFLAAHHHAVAVAMKEVEALASTRIMTDGVS
RTETTGNIVAGLYTHDTSRELDPQLHTHSLVLNATWAEGKWRALASDTKTNHGFYEAMLANQIAIGKVYR
HALRQDIEAMGFETEVTGKHGMWELKGVPTEPFSQRSQQINEAVGPDASPKSRDVAALDTRKDKAVADPD
LLIADWRDRLGKAGFELPLYLAKADERAQGYTVPTPAGTDITQAVSQAISILSDKKVQFSYSELLAATVS
QLPAEQGLITQAREGIEQAIGRERLIPLDKEKGIFTSDIHLLNELSIAQLANEFNKRPPIATFAERATPR
DRPYADAYSVLAQDKAPLAILSGRGGMAQTIERMEDAVLMASEQGREVTILASDNRSARLLAQSQPLAGN
IAPRHTLNAATVFAPHSTLIVEQAESLTLKETLLILEKARASDVQVLMLDSERQRGVGNALSVLKQASVP
QYRFYDAPNIEATVQSVPDKPARFDALAQDYAHRLQQGEQVVAQVSGTRDQQQLTSYIRSVLRDSGQLHG
QDHTLNVLAPVWLDSKTRHQRDTYREGMVMERWDDKGKTMDRYRIDLVADKTHSLVLVSGQGEKHTIKIR
ALDSNWSLFESKRIEVAAGDTLRVLGREAEGTLKAQQTLQVLDAAPGHLHLKTPTGELQLPTDRALKLDH
NYVTGVGVTASQEATVLAAMSARQMSGTGLNQLARSGQHIHIYTPLDQMRAQSKLASHPQFQLASEKLKA
HGDSDQLDTTLKQATASLHTAAEQALHLGLAQVEAKGIVFSTSSLLAAALDFAPATPIDSISAVLDDKLA
KGDLLPVPGKRGDVVSRASFDMEKFIIATIAQGKGTATPYLQQVPDPQLAGLTPGQAQSTRLILESNDQF
IAIQGYAGVGKTTQFKAVLSALDTLPPKQRPTVVGIGPTHRAVHEMQSTGVKAQTLASFLSESRLQAMAG
EQQDHSRTLFLVDESSMIGNRDMAEFYQRVAASGARVVSSGDTAQLKAISSGAPFQLMQERSAVDVAVMK
EIVRQRPELKPAIYSLIDGNLTQSLAQREAVQPGVVPRDPANEPDAWTPDRSVIEAKNPAELVVKDYASR
TRLTRDNTMVIVHLNEVRHGINAAIHQALFDKGELGPRQTSLTILDPVRIEENSLRSSEQVQKNALLGKV
AVLDQHYYTISGIDPQAGTMTIKDNEGKVRLISNIENTAHDLAIYQPREIKVSEGDKIRFTRTVNEHGHV
ANSQWQVKRIEDNGAIVLHDGNNEKTVRPDQFKEDQHIDLGYAITAYGAQGASSTYAIELQAIKGVNRNL
ITLSSAYVPASRAKEHMQTYTDDKEGWINLLNKNLKSQVSTAHDALEGDQIKGLKVADMLLGAASPMRST
ALGRHVLKTHQLDEQQHMGKYIAPGKKYPTPHAAFPVWDNNGKPAGAAMVELQSHHQNKGPTLDSEYRLV
ANERAEFIGLQRASNGETRIATSLEDGIAMATKHPHSGILVSINGAPPPFNVNRMTGGKLVVSDTDAQHL
QKESERELPLPQDMTTKEAKRQDEMIKTVAREKEQPDIKLPDDKQQAVNRDDKRLHNDIHQLNKDAELSE
RQLRKLAEIRDVAKAKFTHELHDKLDKLEREIIKELTKGE
 
Nucleotide Sequence: 5163 bp     [Download]
>gi|145301385|ref|NC_009350.1|:42906-48068 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGCTGTCACTTTCCACCATCAAGGGCAGCGCGGCCTACTACGCTGCCGAGGAAAACTATTACGCCATGG
GCGAGCTCGAATCGGTCTGGATGGGGGAAGGGGCCGACCGCCTTGGACTGAGTGGCCCCATTGACGGGGC
CGACCGCCTTGGACTGAGTGGCCCCATTGACGGGGCCACCCTCGATGCCATTGCCCAGGGTAAACTCCCC
GATGGCACTGAACTCTCGCGCATCGTGGATGGCAAGCAGACTCACCGCACCGGCTATGACCTGACGTTTT
CGGCCCCCAAGAGTGTCTCCGTGATGGCACTGGTGGCGGGTGACGAGCGCTTTCTGGCCGCCCACCATCA
CGCTGTGGCGGTGGCAATGAAGGAGGTCGAGGCGCTGGCCAGCACCCGCATCATGACCGATGGGGTATCG
CGCACCGAGACCACCGGCAACATCGTGGCGGGCCTTTACACCCACGACACCTCCCGCGAACTCGATCCCC
AGCTTCACACCCACTCGCTAGTGCTTAACGCCACCTGGGCCGAGGGCAAATGGCGGGCGCTGGCCAGTGA
CACCAAGACCAACCACGGTTTTTATGAAGCCATGCTCGCCAACCAGATAGCCATAGGCAAGGTGTACCGC
CACGCCCTGCGCCAGGACATCGAGGCGATGGGCTTTGAAACCGAAGTCACCGGCAAACATGGTATGTGGG
AACTCAAGGGAGTACCGACAGAACCATTCAGCCAGCGCAGTCAGCAAATCAACGAGGCTGTAGGCCCCGA
TGCCTCACCAAAATCCCGCGATGTCGCAGCGCTCGATACCCGCAAGGACAAGGCGGTTGCCGACCCCGAT
CTACTGATCGCCGATTGGCGTGATCGCCTGGGCAAAGCAGGCTTTGAACTGCCCCTCTATCTCGCCAAGG
CCGACGAACGTGCCCAGGGATACACCGTCCCCACGCCAGCTGGCACGGATATCACCCAAGCCGTGAGCCA
GGCGATATCCATACTTTCGGATAAAAAGGTACAGTTCTCCTACTCCGAATTACTGGCCGCCACGGTGAGC
CAGCTCCCTGCCGAACAGGGGTTGATCACCCAGGCCCGCGAGGGTATCGAGCAGGCGATTGGGCGCGAGC
GCCTCATCCCGCTCGACAAGGAAAAAGGGATCTTCACCTCCGATATCCATCTGCTCAACGAATTGTCCAT
CGCCCAGCTGGCCAACGAGTTCAACAAGCGCCCCCCGATAGCCACCTTTGCCGAGCGGGCAACCCCGCGT
GATCGCCCCTATGCCGACGCCTACTCTGTGTTGGCCCAGGACAAGGCCCCGCTGGCTATCCTGTCCGGGC
GGGGTGGCATGGCCCAAACCATCGAGCGCATGGAAGATGCCGTGCTCATGGCCAGCGAACAGGGGCGTGA
GGTCACCATCCTGGCCAGCGACAATCGCTCGGCTCGCCTGCTGGCACAAAGCCAGCCTCTGGCAGGCAAT
ATTGCCCCGCGTCACACCCTCAATGCCGCCACGGTCTTTGCCCCTCATAGCACCCTCATTGTCGAGCAGG
CTGAATCCCTGACCCTCAAAGAAACGCTGCTCATCCTGGAAAAGGCACGGGCCAGCGATGTCCAGGTACT
GATGCTCGACAGTGAGCGCCAGCGCGGCGTCGGCAATGCGCTCTCCGTCCTCAAGCAAGCCAGCGTGCCG
CAGTACCGTTTCTATGATGCGCCCAACATCGAGGCCACCGTCCAAAGCGTGCCTGACAAGCCAGCGCGCT
TTGACGCCCTGGCACAGGACTACGCGCATCGTCTGCAGCAAGGCGAGCAGGTGGTTGCCCAGGTCTCCGG
GACACGGGATCAGCAGCAGCTAACCAGCTATATCCGCAGCGTCTTGCGGGATAGCGGCCAACTGCACGGG
CAGGATCACACCCTCAACGTCCTTGCCCCGGTATGGCTCGATAGCAAGACCCGCCATCAGCGTGACACCT
ATCGCGAGGGGATGGTCATGGAGCGGTGGGACGACAAGGGTAAAACCATGGATCGCTATCGCATTGATCT
CGTCGCAGACAAGACCCACTCGCTGGTGCTGGTAAGCGGGCAGGGGGAGAAACACACCATCAAGATCCGT
GCCCTGGACAGCAACTGGTCGCTGTTTGAAAGCAAGCGCATCGAGGTCGCGGCGGGCGACACACTCCGGG
TGCTCGGGCGAGAGGCCGAGGGTACCCTCAAGGCGCAACAGACCCTGCAGGTACTGGACGCGGCCCCTGG
CCACCTGCACCTCAAGACCCCGACCGGTGAGCTGCAACTGCCAACAGACAGGGCACTCAAGCTCGACCAC
AACTATGTTACCGGCGTGGGCGTCACCGCCAGCCAGGAGGCCACCGTACTGGCCGCCATGAGTGCCCGCC
AGATGAGTGGCACAGGGCTTAACCAACTGGCCAGAAGTGGCCAGCATATTCACATCTACACCCCGCTTGA
TCAGATGCGGGCACAGAGCAAGTTAGCCAGTCATCCCCAGTTCCAGCTGGCCAGTGAAAAGCTCAAAGCC
CACGGCGACAGCGACCAGCTCGATACTACGCTCAAGCAGGCCACCGCCAGCCTGCACACAGCGGCTGAGC
AAGCCCTGCATTTGGGGCTGGCCCAGGTGGAAGCCAAAGGCATCGTCTTTTCCACCTCAAGCTTGCTGGC
CGCCGCCCTGGATTTTGCCCCGGCAACCCCGATTGACTCAATCAGCGCCGTGCTCGATGACAAACTCGCC
AAGGGTGACCTGCTGCCGGTGCCCGGCAAGCGCGGCGACGTGGTCTCTCGAGCCAGCTTTGACATGGAAA
AGTTCATTATCGCCACCATTGCCCAAGGCAAGGGAACCGCGACCCCCTACCTGCAGCAGGTACCCGACCC
CCAACTGGCAGGGCTAACCCCTGGCCAGGCACAATCCACTCGCCTGATCCTGGAGAGCAACGACCAGTTC
ATCGCCATCCAGGGCTATGCCGGTGTGGGTAAAACCACCCAGTTCAAGGCCGTGCTGAGTGCACTCGACA
CCCTGCCCCCGAAACAGCGCCCGACCGTGGTCGGGATCGGCCCCACCCACCGGGCCGTCCATGAAATGCA
GTCGACCGGGGTCAAGGCACAGACGCTGGCCTCGTTTCTCTCGGAGAGTCGCCTGCAGGCCATGGCAGGG
GAGCAGCAGGACCACAGCCGCACCCTGTTCCTGGTGGATGAAAGCTCGATGATTGGCAACCGCGACATGG
CGGAGTTTTACCAGCGGGTGGCCGCCAGTGGCGCAAGAGTGGTCAGCAGCGGTGATACCGCGCAGCTCAA
AGCCATCTCGTCAGGTGCCCCGTTCCAACTGATGCAAGAGCGCAGCGCGGTCGATGTGGCTGTCATGAAA
GAGATTGTCCGCCAGCGCCCGGAGCTCAAACCGGCGATCTACAGCTTGATAGATGGCAACCTCACCCAGT
CACTGGCACAGCGCGAAGCGGTGCAACCGGGTGTGGTACCCCGAGACCCGGCAAACGAACCGGATGCCTG
GACACCGGATCGATCGGTGATTGAGGCAAAGAACCCCGCCGAACTGGTGGTCAAGGATTATGCCAGCCGT
ACCCGCCTGACACGGGATAACACCATGGTGATCGTGCATCTCAATGAGGTGCGCCACGGTATTAACGCCG
CAATACACCAGGCACTGTTTGATAAAGGGGAATTAGGCCCACGCCAGACCAGCCTGACAATTCTTGATCC
GGTGCGCATTGAAGAAAATAGCCTGCGTAGCAGTGAGCAGGTACAGAAAAATGCGCTTCTTGGTAAAGTG
GCCGTGCTCGACCAGCACTATTACACCATCAGTGGTATCGACCCCCAGGCCGGGACAATGACCATCAAGG
ATAATGAGGGCAAGGTGCGACTCATCTCCAATATCGAAAACACCGCCCATGATCTCGCTATCTATCAACC
GAGGGAAATAAAGGTCAGTGAAGGCGATAAGATCCGCTTCACCCGCACCGTCAATGAACACGGCCATGTG
GCCAATAGCCAGTGGCAGGTAAAACGCATCGAGGATAATGGCGCGATAGTGCTGCACGATGGCAATAACG
AGAAAACCGTTCGCCCCGACCAATTTAAGGAAGACCAGCACATTGATTTGGGGTATGCCATTACCGCCTA
TGGTGCGCAAGGAGCGAGCAGTACCTACGCCATCGAATTACAGGCGATCAAAGGCGTAAATAGAAACTTG
ATTACCCTGTCGTCTGCGTATGTCCCCGCCTCACGAGCCAAAGAACATATGCAGACCTATACCGATGATA
AGGAAGGCTGGATTAACTTGCTCAATAAAAACCTCAAGAGCCAGGTTAGTACCGCCCACGATGCGCTCGA
AGGCGACCAGATTAAAGGGCTGAAGGTCGCCGATATGTTATTGGGTGCCGCCTCGCCGATGCGCTCCACA
GCATTGGGGCGACATGTGCTAAAGACCCATCAACTCGATGAGCAGCAGCATATGGGAAAATACATTGCAC
CAGGCAAAAAATACCCGACCCCGCACGCTGCCTTTCCGGTGTGGGATAATAATGGTAAACCGGCAGGGGC
TGCCATGGTGGAGCTGCAAAGCCATCACCAAAATAAAGGCCCTACCCTGGACAGTGAATATCGACTGGTG
GCAAATGAACGAGCCGAGTTTATCGGACTCCAGCGTGCCAGTAATGGCGAAACCCGTATCGCAACCAGTT
TAGAGGATGGCATTGCCATGGCGACCAAGCATCCACACAGTGGAATATTGGTCAGCATTAACGGCGCACC
ACCACCATTTAATGTCAATCGGATGACCGGGGGTAAATTGGTCGTGTCGGACACGGATGCGCAGCACCTG
CAAAAAGAGTCAGAGCGGGAGTTACCACTGCCACAAGATATGACCACCAAAGAAGCCAAACGCCAGGACG
AGATGATAAAAACCGTTGCCAGGGAGAAAGAACAGCCGGATATCAAACTGCCTGATGATAAACAGCAAGC
GGTCAATCGCGACGACAAGCGACTCCACAACGATATCCATCAACTAAATAAAGACGCGGAGTTAAGTGAG
CGACAATTGCGTAAGCTGGCAGAAATCAGAGACGTGGCCAAAGCCAAATTTACCCATGAACTCCACGACA
AACTGGATAAGCTGGAAAGGGAGATAATCAAGGAATTGACCAAAGGGGAGTAA
 Primer design

Protein ID: 145301506
T4SS name [ID]Tra_F [130]
Gene symboltraI
Locus tagASA_P5G128
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]121325..126442 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDA4SUM5
KEGG IDasa:ASA_P5G128
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 3.4e-80, Aligned region: 6..281
TraI [PF07057], Evalue: 8.6e-53, Aligned region: 1393..1520
AAA_30 [PF13604], Evalue: 3e-42, Aligned region: 947..1131
Protein Sequence: 1705 a.a.     [Download]
>gi|145301506|ref|YP_001144345.1| TraI protein [Aeromonas salmonicida subsp. salmonicida A449]
MLSLGSSAYYAAEENYYAMGDLESVWMGEGADRLGLSGPIDGATLDAIAQGKLPDGTELSRIVDGKQTHR
TGYDLTFSAPKSVSVMALVAGDERFLAAHHHAVAVAMKEVEALASTRIMTDGITRTETTGNIVAALYTHD
TSRELDPQLHTHSLVLNATYAEGKWRALSSDAAHMNSGFGKDIFNNKLALGQIYRHALRQDVEAMGFETE
VTGKHGLWELKGVPTEPFSQRSQQINDAVGPDASPQSRDAAALDTRKDKAVADPDLLIADWRDRLGKAGF
ELPLYLAKADERAQGYTVPTPAGTDITQAVSQAISILSDKKVQFSYSELLAATVSQLPVEQGLITQAREG
IEQAIGRERLIPLDKEKGIFTSDIHLLNELSIAQLANEFNKRPPIATFAERATPRDRPYANAYSVLAQDK
APLAILSGRGGMAQTIERMEDAVLMASEQGREVTILASDNRSARLLAQSQPLAGNIAPRHTLNAATVFAP
HSTLIVEQAESLTLKETLLILEKARASDVQVLMLDSERQRGVGNALSVLKQASVPQYRFYDAPNIEATVQ
SVPDKPARFDALAQDYAHRLQQGEQVVAQVSGTRDQQQLTSHIRSALRDIGQLHGQDHTLNVLAPVWLDS
KTRHQRDTYREGMVMERWDDKGKTMDRYRIDLVADKTHSLVLANEQGEKHTIKIRALDSNWSLFESKRIE
VAAGDTLRVLGREAEGTLKAQQTLQVLDAAPGHLHLKTPTGELQLPTDRALKLDHNYVTGVGVTASQEAT
VLAAMSARQMSGTGLNQLARSGQHIHIYTPLDQMRAQSKLASHPQFQLASEKLKAHGDSDQLDTTLKQAT
ASLHTAAEQALHLGLAQVEAKGIVFSTSSLLAAALDFAPATPIDSISAVLDDKLAKGDLLPVPGKRGDVV
SRASFDMEKFIIATIAQGKGTATPYLQQVPDPQLAGLTPGQAQSTRLILESNDQFIAIQGYAGVGKTTQF
KAVLSALDTLPPEQRPTVVGIGPTHRAVHEMQSTGVKAQTLASFLSESRLQAMAGEQQDHSRTLFLVDES
SMIGNRDMAEFYQRVAASGARVVSSGDTAQLKAISSGAPFQLMQERSAVDVAVMKEIVRQRPELKPAIYS
LIDGNLTQSLAQREAVQPAVVPRDPANKPDAWTPDRSVIEAKNPAELVVKDYVSRTRLTRDNTMVIVHLN
EVRHGINAAIHQALFDKGELGPRQTSLTILDPVRIEENSLRSSEQVQKNALLGKVAVLNQHYYTISGIDP
QAGTMTIKDNEGKVRLISNIENTAHDLAIYQPREIKVSEGDKIRFTRTVNEHGHVANSQWQVKRIEDNGA
IVLHDGNNEKTVRPDQFKEDQHIDLGYAITAYGAQGASSTYAIELQAIKVVNRNLITLSSAYVPASRAKE
HMQTYTDDKEGWINLLNKNLKSQVSTAHDALEGDQIKGQKVADMLLGTASTMRSTALGRHVLKTHQLDEQ
QHMGKYIAPGKKYPTPHAAFPVWDNNGKPAGAAMVELQSHHQNKGPTLDSEYRLVANERAEFIGLQRASN
GETRIATSLVDGIIMAAKHPQSGILVSINGAPPPFNVNRMTGGKLVVSDTDAQHLQKESERELPLPQDMT
TKESKRQDELIKTVAREKEHPDIKLPDDKQHAVNRDDKRLHNDINQLNKDAELSERQLRKLAEIGEVAKA
KFTHELHDKLDKLEREIIKELTKGE
 
Nucleotide Sequence: 5118 bp     [Download]
>gi|145301385|ref|NC_009350.1|:121325-126442 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGCTGTCACTGGGCAGCTCGGCCTACTACGCTGCCGAGGAAAACTACTACGCCATGGGCGATCTCGAGT
CGGTCTGGATGGGGGAAGGGGCTGACCGCCTTGGACTGAGTGGCCCCATTGACGGGGCCACCCTCGATGC
CATCGCCCAGGGCAAACTCCCCGATGGCACGGAACTCTCGCGCATCGTGGATGGCAAGCAGACCCACCGC
ACCGGCTATGACCTGACGTTTTCGGCCCCCAAGAGTGTCTCCGTGATGGCACTGGTGGCGGGTGACGAGC
GCTTTCTGGCCGCCCACCATCACGCTGTGGCGGTGGCAATGAAGGAGGTCGAGGCGCTGGCCAGCACCCG
CATCATGACCGATGGCATCACCCGCACCGAGACCACCGGCAATATCGTGGCGGCCCTCTACACCCACGAC
ACCTCCCGCGAACTTGATCCGCAGCTGCACACCCACTCACTGGTGCTCAATGCCACCTATGCAGAAGGCA
AATGGCGGGCGCTGAGCAGTGATGCCGCCCACATGAACAGCGGCTTTGGCAAAGACATCTTTAACAACAA
ACTGGCGCTCGGGCAGATATACCGCCACGCCCTGCGCCAGGACGTCGAGGCGATGGGTTTTGAAACAGAG
GTCACCGGCAAGCATGGCCTGTGGGAGCTCAAGGGGGTGCCGACCGAACCATTCAGCCAACGCAGCCAGC
AGATAAACGACGCGGTCGGCCCCGATGCCTCACCCCAGTCCCGCGATGCCGCCGCGCTCGATACCCGCAA
GGACAAGGCGGTTGCCGACCCCGATCTACTGATCGCCGATTGGCGTGATCGCCTGGGCAAAGCAGGCTTT
GAACTGCCCCTCTATCTCGCCAAGGCCGACGAACGCGCCCAGGGATACACCGTCCCCACGCCAGCTGGCA
CGGATATCACCCAAGCCGTGAGCCAGGCGATATCCATACTTTCGGATAAAAAGGTACAGTTCTCCTACTC
CGAATTACTGGCCGCCACGGTGAGCCAGCTCCCCGTCGAACAGGGGTTGATCACCCAGGCCCGCGAGGGT
ATCGAGCAGGCGATTGGACGCGAGCGCCTCATCCCGCTCGACAAGGAAAAAGGGATCTTCACCTCCGATA
TCCATCTGCTCAACGAATTGTCCATCGCCCAGCTGGCCAACGAGTTCAACAAGCGCCCCCCGATAGCCAC
CTTTGCCGAGCGGGCAACCCCGCGTGATCGTCCCTATGCCAACGCCTACTCCGTGTTGGCCCAGGACAAG
GCCCCGCTGGCTATCCTGTCCGGACGGGGTGGCATGGCCCAAACCATCGAGCGCATGGAAGATGCCGTGC
TCATGGCCAGCGAACAGGGGCGTGAGGTCACCATCCTGGCCAGCGACAATCGCTCGGCTCGCCTGCTGGC
ACAAAGCCAGCCTCTGGCAGGCAATATTGCCCCGCGTCACACCCTCAATGCCGCCACGGTCTTTGCCCCT
CATAGCACCCTCATTGTCGAGCAGGCTGAATCCCTGACCCTCAAAGAAACGCTGCTCATCCTGGAAAAGG
CACGGGCCAGCGATGTCCAGGTACTGATGCTCGACAGTGAGCGCCAGCGCGGCGTCGGCAATGCGCTCTC
CGTCCTCAAGCAAGCCAGCGTGCCGCAGTACCGTTTCTATGATGCGCCCAACATCGAGGCCACCGTCCAG
AGCGTGCCTGACAAGCCAGCGCGTTTTGACGCCCTGGCACAGGACTACGCGCATCGTCTGCAGCAAGGCG
AGCAGGTGGTTGCCCAGGTCTCCGGGACACGGGATCAGCAGCAGCTAACCAGCCATATCCGCAGCGCCTT
GCGGGATATCGGCCAACTGCACGGGCAGGATCACACCCTCAACGTCCTTGCCCCGGTATGGCTCGATAGC
AAGACCCGCCATCAGCGTGACACCTATCGCGAGGGGATGGTCATGGAGCGGTGGGACGACAAGGGTAAAA
CCATGGATCGCTATCGCATTGATCTCGTCGCAGACAAGACCCACTCGCTGGTGCTGGCCAACGAGCAGGG
GGAGAAACACACCATCAAGATCCGCGCCCTGGACAGCAACTGGTCGCTGTTTGAAAGCAAGCGCATCGAG
GTCGCGGCGGGCGACACACTCCGGGTGCTCGGGCGAGAGGCCGAGGGCACCCTCAAGGCGCAACAGACCC
TGCAGGTACTGGACGCGGCCCCTGGCCACCTGCACCTCAAGACCCCGACCGGTGAGCTGCAACTGCCAAC
AGACAGGGCACTCAAGCTCGACCACAACTATGTTACCGGCGTGGGCGTCACCGCCAGCCAGGAGGCCACC
GTACTGGCCGCCATGAGTGCCCGCCAGATGAGTGGCACAGGGCTTAACCAACTGGCCAGAAGTGGCCAGC
ATATTCACATCTACACCCCGCTTGATCAGATGCGGGCACAGAGCAAGTTAGCCAGTCATCCCCAGTTCCA
GCTGGCCAGTGAAAAGCTCAAAGCCCACGGCGACAGCGACCAGCTCGATACTACGCTCAAGCAGGCCACC
GCCAGCCTGCACACAGCGGCTGAGCAAGCCCTGCATTTGGGGCTGGCCCAGGTGGAAGCCAAAGGCATCG
TCTTTTCCACCTCAAGCTTGCTGGCCGCCGCCCTGGATTTTGCCCCGGCAACCCCGATTGACTCAATCAG
CGCCGTGCTCGATGACAAACTCGCCAAGGGTGACCTGCTGCCGGTGCCCGGCAAGCGCGGCGACGTGGTC
TCTCGAGCCAGCTTTGACATGGAAAAGTTCATTATCGCCACCATTGCCCAAGGCAAGGGAACCGCGACCC
CCTACCTGCAGCAGGTACCCGACCCCCAACTGGCAGGGCTAACCCCTGGCCAGGCACAATCCACTCGCCT
GATCCTGGAGAGCAACGACCAGTTCATCGCCATCCAGGGCTATGCCGGTGTGGGTAAAACCACCCAGTTC
AAGGCTGTGCTGAGTGCACTCGACACCCTGCCCCCGGAACAGCGCCCGACCGTGGTCGGGATTGGCCCCA
CCCACCGGGCCGTCCATGAAATGCAGTCCACCGGGGTCAAGGCACAGACGCTGGCCTCGTTTCTCTCGGA
GAGTCGCCTGCAGGCCATGGCAGGGGAGCAGCAGGACCACAGCCGCACCCTGTTCCTGGTGGATGAAAGC
TCGATGATTGGCAACCGCGACATGGCGGAGTTTTACCAGCGGGTGGCCGCCAGTGGCGCAAGGGTGGTCA
GCAGCGGTGATACCGCGCAGCTCAAAGCCATCTCGTCAGGTGCCCCGTTCCAACTGATGCAAGAGCGCAG
CGCGGTCGATGTGGCTGTCATGAAAGAGATTGTCCGCCAGCGCCCGGAGCTCAAACCGGCGATCTACAGC
TTGATAGATGGCAACCTCACCCAGTCACTGGCACAGCGCGAAGCGGTGCAACCGGCTGTGGTACCCCGAG
ACCCGGCAAACAAACCGGATGCCTGGACACCGGATCGCTCGGTGATTGAGGCAAAGAACCCCGCCGAACT
GGTGGTCAAAGATTATGTCAGCCGCACCCGTCTTACACGGGATAACACCATGGTGATCGTGCATCTCAAT
GAGGTGCGCCACGGTATTAACGCCGCAATACACCAGGCACTGTTTGATAAAGGGGAATTAGGTCCACGCC
AGACCAGCCTGACCATTCTTGATCCGGTGCGCATTGAAGAAAATAGCCTGCGTAGCAGTGAGCAGGTACA
GAAAAATGCGCTCCTTGGTAAAGTGGCCGTGCTTAACCAGCACTATTACACCATCAGTGGTATCGACCCC
CAGGCCGGGACAATGACCATCAAGGATAATGAGGGCAAGGTGCGACTCATCTCCAATATCGAAAACACCG
CCCATGATCTCGCTATCTATCAACCGAGGGAAATAAAGGTCAGTGAAGGCGATAAGATCCGCTTCACCCG
CACCGTCAATGAACACGGCCATGTAGCCAATAGCCAGTGGCAGGTAAAACGCATCGAGGATAATGGCGCG
ATAGTGCTGCACGATGGCAATAACGAGAAAACCGTTCGCCCCGACCAATTTAAAGAAGACCAGCACATTG
ATTTGGGATATGCCATTACCGCCTATGGTGCGCAAGGGGCGAGCAGTACTTACGCCATCGAATTACAGGC
GATCAAAGTCGTAAATAGAAACTTGATTACCCTGTCGTCTGCGTATGTCCCCGCCTCACGTGCCAAAGAA
CATATGCAGACCTATACCGATGATAAGGAAGGCTGGATTAACTTGCTCAATAAAAACCTCAAGAGCCAGG
TTAGTACCGCCCACGATGCGCTCGAAGGAGACCAGATTAAAGGGCAAAAGGTCGCAGATATGTTATTGGG
TACCGCCTCGACGATGCGCTCTACCGCATTAGGACGGCATGTGCTGAAGACCCATCAACTCGATGAGCAG
CAGCATATGGGAAAATACATTGCACCAGGCAAAAAATACCCGACCCCGCACGCTGCCTTTCCGGTGTGGG
ATAATAATGGTAAACCGGCAGGGGCTGCCATGGTGGAGCTGCAAAGCCATCACCAAAATAAAGGCCCTAC
CCTGGACAGTGAATATCGACTGGTGGCAAATGAACGAGCCGAGTTTATCGGACTCCAGCGTGCCAGTAAT
GGCGAAACCCGTATCGCCACCAGTTTGGTTGATGGAATTATCATGGCAGCCAAGCATCCACAAAGTGGAA
TATTGGTCAGCATTAACGGCGCACCACCACCATTTAATGTCAATCGGATGACCGGGGGTAAATTGGTTGT
GTCGGACACGGATGCGCAGCACCTGCAAAAAGAGTCAGAGCGTGAGTTACCACTGCCACAAGATATGACC
ACCAAAGAATCCAAACGCCAGGACGAGCTGATAAAAACAGTGGCCAGGGAAAAAGAACACCCGGATATCA
AACTGCCTGATGATAAACAGCATGCGGTCAATCGCGACGACAAGCGACTCCACAACGATATCAATCAACT
CAATAAAGACGCGGAGTTAAGTGAGCGACAATTGCGTAAGTTGGCAGAAATCGGAGAAGTGGCCAAAGCC
AAATTTACCCATGAACTCCACGACAAACTGGATAAGCTGGAAAGGGAGATCATCAAGGAATTGACCAAGG
GGGAGTAA
 Primer design