SecReT4
Protein ID: 145301507
T4SS name [ID]Tra_F [130]
Gene symboltraM
Locus tagASA_P5G129
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]126478..126846 [-]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDA4SUM6
KEGG IDasa:ASA_P5G129
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 4e-45, Aligned region: 1..120
Protein Sequence: 122 a.a.     [Download]
>gi|145301507|ref|YP_001144346.1| conjugal transfer protein TraM [Aeromonas salmonicida subsp. salmonicida A449]
MPRVQVYLKHNCIDEIHELVEEDIQAGANPAEVSFSSKACMLLELGLRVYNLRRSEHAGSGHDDFDRVLL
QTCLESMFLSQHLTAKLGNMEKGEKELLRVSIDRKVAEKMEPFFPATDDEQD
 
Nucleotide Sequence: 369 bp     [Download]
>gi|145301385|ref|NC_009350.1|:c126846-126478 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGCCAAGAGTTCAGGTATATCTTAAGCACAATTGCATTGATGAGATACATGAGTTAGTTGAGGAGGATA
TTCAGGCTGGCGCAAACCCGGCAGAGGTCAGTTTTTCCAGTAAAGCCTGTATGTTATTGGAGCTGGGACT
GCGAGTTTACAATCTTCGGCGCTCTGAGCATGCAGGAAGTGGCCATGACGACTTTGACCGGGTATTATTG
CAAACTTGCCTGGAGTCCATGTTTCTCAGCCAGCACCTGACAGCCAAGCTTGGTAATATGGAAAAAGGTG
AAAAAGAGTTGTTGCGAGTATCTATTGATAGGAAGGTGGCAGAAAAGATGGAGCCCTTCTTTCCTGCTAC
TGACGATGAGCAGGACTGA
 Primer design