SecReT4
Protein ID: 145301508
T4SS name [ID]Tra_F [130]
Gene symbol-
Locus tagASA_P5G130
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]127437..127877 [+]
ProductX protein
Component typeOrf169_F
UniProt IDA4SUM7
KEGG IDasa:ASA_P5G130
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|145301508|ref|YP_001144347.1| X protein [Aeromonas salmonicida subsp. salmonicida A449]
MAADCFDMAGQAYRIDPDLLRATAFRESSFNPRALNVVSDKKYAVGLMQIHSQHFAKLAQFGITPMGLYN
DPCLNIYTGAYYMAHAIKRMGYNWDAVGAYYAGFSTSAKQAEKRKWYAERVKLTYDEIKKGPKHQGPNNS
KGSKPD
 
Nucleotide Sequence: 441 bp     [Download]
>gi|145301385|ref|NC_009350.1|:127437-127877 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGGCTGCCGATTGTTTCGATATGGCGGGGCAGGCTTACCGTATTGATCCTGATTTACTACGCGCAACAG
CCTTTCGTGAATCCAGTTTTAACCCCCGCGCCTTGAATGTCGTCTCTGATAAAAAATATGCCGTTGGATT
AATGCAAATTCATTCCCAGCACTTCGCCAAATTGGCACAATTCGGGATCACGCCAATGGGTCTATACAAT
GATCCTTGTTTGAATATCTACACGGGAGCCTATTACATGGCACACGCCATTAAACGGATGGGGTATAATT
GGGACGCGGTAGGGGCTTACTATGCTGGATTTTCCACATCAGCCAAGCAGGCAGAAAAACGTAAATGGTA
CGCCGAACGGGTCAAGCTCACGTATGACGAGATCAAAAAAGGCCCCAAACATCAGGGGCCAAATAACAGC
AAGGGAAGCAAACCTGATTAA
 Primer design