SecReT4
Protein ID: 145306765
T4SS name [ID]VirB [613]
Gene symbol-
Locus tagMGR_P0024
StrainMagnetospirillum gryphiswaldense MSR-1
Repliconplasmid pMSR-1 [GenBank: NC_009353] [Browse all T4SS(s) in this replicon]
Location [Strand]20784..22592 [-]
ProductTRAG protein
Component typeVirD4
UniProt IDA4U5U6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.9e-110, Aligned region: 96..565
TraG-D_C [PF12696], Evalue: 6.3e-34, Aligned region: 399..520
TrwB_AAD_bind [PF10412], Evalue: 1.5e-22, Aligned region: 213..522
Protein Sequence: 602 a.a.     [Download]
>gi|145306765|ref|YP_001144429.1| TRAG protein [Magnetospirillum gryphiswaldense MSR-1]
MIVLAIPFAVAGAFAALFYAWQEIYGFHATQGDSWAWVWKYLQAYGQPPGFIQWGIFGATAGTIALILLI
QAIAMRIGGQTRHGSYDEKNLHGSARWARKADVKEAGLLRKTGVVVGGWPKWRGAKTLRHDGPEHILTFA
PTRSGKGVGLVLPTLLSWPSSVLVLDIKGENWRLTSGWRASQGQRILKFDPTAEEGACHYNPLAEVRIGT
GHEVADAQNIATMIIDPDGKGLADFWQKSGYAWLTGAILYTLYKIRRDENRIASLPDIDAVLTAVGEGLD
SLLADMVSVEAGTEAATRLIQAAAQEMRDRAAQERSGVQSSSKVDLSLYRDPMIARNISGSDFRLDELMN
SEVPLSLYIIIPPSDIDRLRPLLRIILNLFMRRLMQNVGADGRATHKHRLLLMLDEFTSIGKLEIFERSL
AFMAGYGLKAFLIIQDLLQLQGTYGKENSIMGNCHIRIAYAPNDVTTAKTLSDMCGKATIVQTKRSRSRR
ALQVIGGNVTDNVSEVGRPLLTPDECMRLKAARKSRRDPEKIVEAGDMLVFSAGAPPILGRQPLYFFDKT
LLARSRMAPVGTVEAANDESVPQAEPPMPSPITARLRAAGQS
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|145306741|ref|NC_009353.1|:c22592-20784 Magnetospirillum gryphiswaldense MSR-1 plasmid, complete sequence
ATGATCGTTCTGGCCATTCCCTTTGCCGTTGCCGGCGCTTTTGCCGCCTTGTTCTATGCGTGGCAGGAAA
TCTATGGATTTCACGCCACGCAGGGCGATTCCTGGGCCTGGGTGTGGAAGTACCTGCAAGCCTATGGCCA
GCCCCCCGGCTTCATCCAGTGGGGCATCTTCGGCGCCACCGCCGGCACTATCGCCCTGATCCTGCTGATC
CAGGCCATCGCCATGCGGATCGGCGGCCAAACCCGGCACGGCAGTTACGACGAAAAGAACCTGCACGGCT
CGGCCCGCTGGGCCAGGAAGGCCGACGTCAAGGAAGCCGGGTTGCTGCGTAAGACCGGTGTCGTCGTCGG
CGGCTGGCCCAAATGGCGCGGCGCCAAGACCCTGCGCCATGATGGCCCCGAACACATCTTGACCTTTGCC
CCCACCCGTTCCGGCAAAGGTGTCGGGCTGGTGCTGCCGACCTTGCTGTCGTGGCCGTCTTCCGTCCTGG
TGTTGGATATCAAGGGCGAGAACTGGCGGCTGACCTCGGGCTGGCGGGCCAGCCAGGGTCAACGCATCCT
CAAGTTCGATCCCACGGCGGAAGAGGGGGCTTGCCATTACAATCCGTTGGCCGAGGTCAGGATCGGTACC
GGGCACGAGGTCGCGGACGCCCAGAACATCGCCACCATGATCATTGACCCGGACGGCAAGGGCTTGGCCG
ATTTCTGGCAGAAATCGGGCTATGCGTGGCTGACCGGGGCCATCCTCTACACCCTTTACAAAATCCGCCG
CGACGAAAACCGCATCGCCTCCCTGCCCGACATTGATGCCGTGCTGACCGCTGTCGGCGAAGGCCTGGAT
TCCCTGCTGGCCGACATGGTGTCGGTCGAGGCCGGGACCGAAGCGGCGACACGGCTGATCCAGGCGGCGG
CGCAGGAAATGCGCGACCGCGCAGCGCAAGAACGCTCCGGCGTTCAATCGTCGTCCAAGGTCGATCTGTC
GCTGTACCGCGACCCGATGATTGCCCGGAACATTTCCGGCTCGGATTTCCGCCTGGATGAGTTGATGAAC
AGCGAGGTGCCGCTGTCGCTCTACATCATCATTCCGCCGTCGGACATTGATCGGCTGCGGCCCTTGCTGC
GCATCATCCTCAACTTGTTCATGCGCCGGCTGATGCAGAACGTCGGCGCCGATGGCAGGGCCACCCATAA
ACACCGCCTGTTGCTGATGCTCGATGAGTTCACCTCCATCGGCAAACTGGAAATCTTTGAACGCTCGCTC
GCCTTCATGGCTGGGTATGGGCTGAAGGCCTTCCTGATCATCCAGGACCTTCTTCAGCTTCAAGGCACCT
ACGGCAAAGAAAATTCCATCATGGGCAATTGCCATATCCGCATTGCCTATGCCCCCAACGACGTGACGAC
GGCGAAAACGCTGTCGGATATGTGCGGCAAGGCCACCATCGTTCAGACCAAGCGCAGCCGCAGCCGGCGG
GCGCTTCAGGTCATCGGCGGCAACGTCACCGATAATGTGTCTGAGGTCGGGCGCCCCTTGCTGACGCCGG
ACGAATGCATGCGCCTGAAAGCGGCACGCAAATCCAGGCGCGATCCCGAAAAGATCGTCGAGGCCGGCGA
CATGCTGGTGTTTTCGGCAGGCGCCCCGCCGATCCTGGGGCGTCAGCCGCTTTATTTCTTCGACAAGACA
CTGCTGGCGCGCTCGCGCATGGCCCCGGTCGGCACCGTCGAGGCCGCCAATGACGAAAGCGTCCCCCAGG
CCGAACCACCGATGCCGTCACCGATCACCGCCCGGCTGCGCGCCGCCGGCCAATCGTAA
 Primer design