SecReT4
Protein ID: 145306766
T4SS name [ID]VirB [613]
Gene symbol-
Locus tagMGR_P0025
StrainMagnetospirillum gryphiswaldense MSR-1
Repliconplasmid pMSR-1 [GenBank: NC_009353] [Browse all T4SS(s) in this replicon]
Location [Strand]22589..23542 [-]
Producttype II/IV secretion system protein
Component typeVirB11
UniProt IDA4U5U7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-30, Aligned region: 11..286
Protein Sequence: 317 a.a.     [Download]
>gi|145306766|ref|YP_001144430.1| type II/IV secretion system protein [Magnetospirillum gryphiswaldense MSR-1]
MSSAISIILRPLAAYYDDPTTVEMRMTRPKQVIIDRRGHGKIIVAAPELTLARIEDICRSLANFTGVKFD
PDTSPKLSCIIPEVRHRFECLVGSSAPYGVSMAIRCKHPFTPTWEQVGASPEIVEYLKSAMAAELNMIIS
GATNTGKTTFINKLLDFLPEDRRVVALEDTPELHMDRFWDGVALLAAREASTASGMIDWRQLYDHQMRIT
PDNVIFGEISTQNAFAALGSLNSGITGFMCTIHAASPYQVLHRKFDQNIAWSGQSMPRVPEFLAELVDVI
VQIKRSSDGWRRITDIYEPCHDRWVMKDGHFLERNAA
 
Nucleotide Sequence: 954 bp     [Download]
>gi|145306741|ref|NC_009353.1|:c23542-22589 Magnetospirillum gryphiswaldense MSR-1 plasmid, complete sequence
ATGTCGTCGGCGATCTCCATCATCCTGCGTCCGCTGGCGGCGTATTACGACGATCCGACCACCGTCGAAA
TGCGCATGACCCGGCCCAAGCAGGTCATCATCGACCGGCGCGGCCACGGCAAGATCATCGTGGCCGCGCC
GGAACTGACCCTGGCCCGCATCGAGGACATATGCCGCAGCTTGGCCAACTTCACCGGGGTCAAGTTCGAC
CCCGACACCTCGCCCAAGCTGTCGTGCATAATCCCCGAGGTGCGCCACCGTTTCGAGTGTCTGGTCGGAT
CGTCGGCGCCCTACGGCGTCTCCATGGCCATCCGCTGCAAACATCCCTTCACCCCCACCTGGGAACAGGT
GGGGGCAAGCCCTGAAATCGTCGAATACCTGAAATCCGCCATGGCGGCGGAATTGAACATGATCATTTCG
GGGGCCACCAACACCGGCAAGACCACCTTCATCAACAAGCTGCTGGATTTTCTGCCCGAGGATCGGCGCG
TCGTCGCCCTTGAGGATACGCCGGAACTGCACATGGACCGGTTCTGGGATGGCGTCGCCCTGCTGGCCGC
CCGCGAGGCCTCGACCGCCTCGGGCATGATCGACTGGCGCCAACTCTATGATCACCAGATGCGCATCACC
CCCGATAACGTGATTTTCGGGGAGATTTCAACGCAGAACGCCTTTGCCGCCTTGGGCTCGCTCAATTCCG
GCATCACCGGCTTCATGTGCACCATCCATGCCGCCAGCCCCTATCAGGTGCTGCACCGCAAGTTCGACCA
GAACATCGCCTGGTCGGGCCAAAGCATGCCCCGCGTGCCCGAATTCCTGGCCGAGCTGGTGGACGTGATC
GTCCAGATCAAGCGCAGCAGCGATGGCTGGCGCCGCATCACCGACATCTATGAACCGTGCCATGACCGCT
GGGTCATGAAGGACGGTCACTTTCTCGAAAGGAACGCCGCATGA
 Primer design