SecReT4
Protein ID: 145306770
T4SS name [ID]VirB [613]
Gene symbol-
Locus tagMGR_P0029
StrainMagnetospirillum gryphiswaldense MSR-1
Repliconplasmid pMSR-1 [GenBank: NC_009353] [Browse all T4SS(s) in this replicon]
Location [Strand]27772..28533 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDA4U5V1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-19, Aligned region: 41..248
Protein Sequence: 253 a.a.     [Download]
>gi|145306770|ref|YP_001144434.1| hypothetical protein MGR_P0029 [Magnetospirillum gryphiswaldense MSR-1]
MHRLPWLKRLFKGKARRRRRPALFNPVDHSAVRAADPYAFEAAHRRLAWMLRLTVMVVVGLGGVVIVQAS
AISTLVPLKEVQLGLVRIEQHGGKTVPVDPATMVRVLPITKDTPGFDLLMESFVRRYVRILLEIDTASQG
DRMREANMHSDTTWWKKFTDERLKEITTALDTKLNRSVVVESADRISFRDNIGRYAVDIVQTDERGGKVV
ETRKLRAYLAVTSRPHTVRESEKFENPLGLRVLDVSLKERGNS
 
Nucleotide Sequence: 762 bp     [Download]
>gi|145306741|ref|NC_009353.1|:c28533-27772 Magnetospirillum gryphiswaldense MSR-1 plasmid, complete sequence
ATGCACCGCTTGCCCTGGCTGAAACGCCTGTTCAAAGGCAAAGCCCGCCGGCGCCGGCGACCGGCCTTAT
TCAATCCGGTCGATCACAGCGCCGTGCGCGCCGCCGATCCCTATGCCTTCGAGGCGGCACACCGCCGGCT
GGCCTGGATGCTGCGCTTGACGGTGATGGTGGTGGTCGGCCTGGGCGGCGTCGTCATCGTCCAGGCCTCG
GCGATCTCCACCCTGGTGCCGTTGAAGGAAGTCCAACTCGGTCTGGTCCGTATCGAACAGCATGGCGGCA
AGACCGTGCCGGTCGATCCCGCCACCATGGTCCGGGTGCTGCCGATCACCAAGGATACGCCTGGGTTCGA
TCTGCTGATGGAAAGCTTCGTGCGGCGCTATGTCCGCATCCTGCTGGAAATCGACACCGCGTCGCAAGGC
GACCGCATGCGCGAAGCCAACATGCATTCAGACACCACCTGGTGGAAGAAATTCACCGACGAGCGGCTGA
AGGAAATCACCACCGCGCTCGACACCAAGCTCAACCGTTCCGTCGTCGTCGAAAGCGCTGACCGTATTTC
CTTCCGCGACAATATCGGGCGCTACGCCGTCGATATCGTCCAGACCGACGAACGCGGCGGCAAGGTGGTC
GAGACCCGCAAGCTGCGGGCTTATCTGGCCGTCACCTCACGCCCGCATACGGTGCGGGAAAGCGAAAAAT
TCGAAAATCCATTGGGGCTGCGCGTCCTTGATGTCTCGCTCAAGGAAAGGGGGAATTCATGA
 Primer design