SecReT4
Protein ID: 145597273
T4SS name [ID]Tra_F [118]
Gene symbol-
Locus tagYPDSF_4109
StrainYersinia pestis Pestoides F
Repliconplasmid MT [GenBank: NC_009378] [Browse all T4SS(s) in this replicon]
Location [Strand]88951..89700 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDA4TSZ8
KEGG IDypp:YPDSF_4109
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.4e-75, Aligned region: 25..239
Protein Sequence: 249 a.a.     [Download]
>gi|145597273|ref|YP_001154743.1| conjugal pilus assembly protein TraF [Yersinia pestis Pestoides F]
MKKRKTALALLLLGSVFSATGKDAGWQWYNESHRTPEDDKSSSAQPQQASPDIMEKLATLQQATKRAMYE
AILYPGVENFTRYFRLQNYWTQQAGLFSMSAKKAMLEHPELDYNLQHSHYNGTVRNQLAADFADQRLAIE
TLAQRYGVMFFYRGQDPIDGQLVQVIKNFRETYHLSVIPVSVDGIVNPLLPDTRMDGGQASRLGIRYFPA
LMLADPKSGTVKPVSYGFISQDDLAKQFLNVSTDFAPNF
 
Nucleotide Sequence: 750 bp     [Download]
>ref|NC_009378.1|:c89700-88951 conjugal pilus assembly protein TraF [Yersinia pestis Pestoides F]
GTGAAAAAGAGAAAGACAGCGTTAGCGCTGCTGCTTCTTGGCAGCGTTTTTTCCGCCACAGGAAAAGATG
CCGGCTGGCAGTGGTACAACGAATCGCACAGAACGCCGGAGGACGACAAATCCTCTTCAGCACAGCCTCA
GCAGGCCTCGCCGGACATCATGGAGAAGCTTGCCACGCTTCAGCAGGCCACGAAGCGCGCCATGTACGAG
GCCATTCTGTATCCGGGCGTGGAGAACTTTACCCGTTACTTCCGCCTGCAGAACTACTGGACGCAGCAGG
CCGGGCTGTTCTCGATGAGTGCTAAAAAGGCGATGCTCGAGCACCCCGAACTGGACTACAACCTGCAGCA
CAGCCACTACAACGGTACCGTGCGCAACCAGCTGGCGGCGGACTTTGCCGACCAGCGCCTCGCCATTGAA
ACGCTGGCACAGCGCTATGGCGTGATGTTCTTCTACCGCGGACAGGACCCGATCGACGGCCAGCTGGTTC
AGGTCATTAAAAACTTCCGCGAGACGTATCACCTCAGCGTCATTCCGGTCTCTGTGGACGGTATCGTGAA
TCCACTCCTGCCGGATACCCGAATGGACGGTGGACAGGCCAGCCGGCTGGGTATTCGTTACTTCCCGGCG
CTGATGCTGGCCGACCCTAAAAGCGGGACGGTCAAACCCGTCTCGTATGGCTTTATCAGCCAGGATGACC
TGGCGAAGCAGTTCCTCAACGTTTCCACAGATTTTGCCCCCAACTTTTAA
 Primer design