SecReT4
Protein ID: 145597285
T4SS name [ID]Tra_F [118]
Gene symbol-
Locus tagYPDSF_4121
StrainYersinia pestis Pestoides F
Repliconplasmid MT [GenBank: NC_009378] [Browse all T4SS(s) in this replicon]
Location [Strand]101777..102082 [-]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDA4TSY4
KEGG IDypp:YPDSF_4121
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.3e-37, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|145597285|ref|YP_001154755.1| conjugal transfer pilus assembly protein TraL [Yersinia pestis Pestoides F]
MADESLTKYRFPETLTNQSRWFGLPVDELIPAIVCLGWGFWTQHYIPGIIAAVLAYLGIKKLKKGRGSSW
LRDLVYWYMPTSLLRGIFHDVPDSCYRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>ref|NC_009378.1|:c102082-101777 conjugal transfer pilus assembly protein TraL [Yersinia pestis Pestoides F]
ATGGCAGATGAATCTCTCACAAAATATCGCTTTCCCGAAACCCTGACGAATCAGAGCCGCTGGTTTGGCC
TTCCTGTGGATGAACTTATTCCGGCCATTGTCTGCCTGGGGTGGGGATTCTGGACCCAGCATTATATTCC
CGGAATTATCGCTGCCGTACTGGCCTATCTCGGAATTAAAAAGCTCAAGAAAGGGCGGGGCAGTTCATGG
CTGCGGGACCTGGTCTACTGGTATATGCCGACCTCACTGCTGAGGGGGATTTTTCATGATGTACCCGACT
CATGCTACCGCCAGTGGATTAAATAG
 Primer design