SecReT4
Protein ID: 145597290
T4SS name [ID]Tra_F [118]
Gene symbol-
Locus tagYPDSF_4126
StrainYersinia pestis Pestoides F
Repliconplasmid MT [GenBank: NC_009378] [Browse all T4SS(s) in this replicon]
Location [Strand]111435..112172 [+]
Productconjugative transfer fimbrial acetylation protein
Component typeTraX_F
UniProt IDA4TSX4
KEGG IDypp:YPDSF_4126
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 1.7e-51, Aligned region: 29..244
Protein Sequence: 245 a.a.     [Download]
>gi|145597290|ref|YP_001154760.1| conjugative transfer fimbrial acetylation protein [Yersinia pestis Pestoides F]
MRAENHPLFPLVVVADCWLQRLLVWTPGQTDLIKTVALLLMVADHISMLCGLDNDWLRLAGRGAFPLFGL
VWAMNLARHPQIQQRALNRLWIWAGVAQGGWILAGLRPDLGNILFAFAVSGQALALMQRHGPRTWPLSLM
LVLAWLPFSAGSYGLAGVVMLMLACGVCMTGRRTTRTGLALCLALAILALNAADSPAFAIAGLVIPGVTL
TVLSRTCCRVPRFWPREFFPLFYAVHLAVIGLMVM
 
Nucleotide Sequence: 738 bp     [Download]
>ref|NC_009378.1|:111435-112172 conjugative transfer fimbrial acetylation protein [Yersinia pestis Pestoides F]
ATGCGCGCTGAAAACCATCCGCTCTTCCCCCTTGTGGTGGTGGCCGACTGCTGGCTGCAGCGTCTGCTTG
TGTGGACGCCGGGCCAGACCGACCTTATCAAAACCGTGGCGCTCCTCCTGATGGTGGCCGACCACATCAG
CATGCTGTGCGGACTGGATAATGACTGGCTGCGTCTTGCCGGTCGGGGAGCGTTTCCGCTCTTTGGCCTG
GTCTGGGCCATGAACCTCGCCCGCCATCCGCAGATTCAGCAGCGCGCCCTGAACCGGCTCTGGATATGGG
CCGGGGTGGCGCAGGGCGGCTGGATACTGGCCGGGCTGCGCCCGGACCTGGGCAATATCCTGTTTGCCTT
TGCGGTCAGCGGACAGGCGCTGGCGCTGATGCAGCGGCACGGGCCGCGCACGTGGCCGCTCTCCCTGATG
CTGGTTCTGGCCTGGCTGCCGTTTTCGGCGGGAAGCTACGGGCTGGCGGGGGTAGTGATGCTGATGCTGG
CCTGCGGCGTATGTATGACGGGCCGGCGCACCACGCGCACGGGGCTGGCGCTGTGTCTGGCACTGGCGAT
ACTCGCGCTGAATGCCGCGGACAGCCCCGCCTTTGCCATCGCGGGTCTGGTAATACCCGGCGTTACCCTG
ACAGTGCTGAGTCGGACCTGTTGCCGCGTGCCGAGGTTCTGGCCGCGCGAATTTTTCCCGCTGTTCTACG
CGGTGCACCTTGCCGTCATCGGACTGATGGTGATGTGA
 Primer design