SecReT4
Protein ID: 146275589
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_3982
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]147458..149788 [+]
ProductType IV secretory pathway VirD4 components-like protein
Component typeTraD_F
UniProt IDA4XE63
KEGG IDnar:Saro_3982
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.3e-141, Aligned region: 226..610
T4SS-DNA_transf [PF02534], Evalue: 3.6e-21, Aligned region: 237..396
T4SS-DNA_transf [PF02534], Evalue: 3.6e-21, Aligned region: 431..595
TraG-D_C [PF12696], Evalue: 2.9e-19, Aligned region: 470..591
AAA_10 [PF12846], Evalue: 5.5e-13, Aligned region: 240..282
AAA_10 [PF12846], Evalue: 5.5e-13, Aligned region: 443..546
Protein Sequence: 776 a.a.     [Download]
>gi|146275589|ref|YP_001165750.1| Type IV secretory pathway VirD4 components-like protein [Novosphingobium aromaticivorans DSM 12444]
MRRPDTWSDQARPGQLKHHSARGNMPRNAGNFTRGSQLITHEFLMWFSSAKMPLLVWFFTFLIALSIVLA
LLLHEHEVQMILMRIYAEGWSFMEFSPRKILNLTLPSGRVIPAPVSMIASHPDVVIAWNKLMRAIWGSLF
ISLFVAVPLSVWFIDLSRKRGKAILEERHQRGAMLVDAKELAAVINQHNSAALAQEIAERMPGKTMDDVM
KMSFAERKAAGIHHVYNIAGVSFPWRSEQAHTIMIGSTGTGKTTQMRDMIAQMRVRQDRAVVFDLTGAYV
EAFYNPETDTILNPMDERCPSWSLFDEGKNYADFTAIASAILPTDGGGSDPFWMLGARTLFVQTCVQLMK
LGQATNAALAYRLMMADLEEVHELLRNTIAEPLTAPVAARMAESVRAVLNTNAQALLFIPEGKEPFSICD
WIRHQDKPGSILFITSSHNELVLNRALLSLWMNLAVHTLMRLPRTRSLRTWFFFDEVHALHRLPAIEDGL
QTARGFGGAFVLGIHSFAKLAETYGKEGAQNLASLARTKLILAAADRDTAEHCSDYIGHREVRMMDEAYS
YGYSNIRDAATITPRSEVQPLVIPDDIMRLPSLRGFLVFPEGFDAARIRLTYKDYPKVAEGYILRENVEP
IEFISMPKGDDEVAETGGRDRSGEPELEPRGEDLGRDPAVPLSPALEPDANAPEIMPDGPNPDPSVGKQM
AFRLEQAPQNERTNSREQDPSQKAEKSSASKPAAQRTVGSRELNDPAIPDKESERGAKTAKGIEDQSHSR
DDGPEL
 
Nucleotide Sequence: 2331 bp     [Download]
>gi|146275443|ref|NC_009426.1|:147458-149788 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGCGTCGTCCTGACACCTGGTCCGATCAGGCCCGCCCCGGCCAGCTCAAGCACCATTCGGCGCGCGGGA
ACATGCCGCGCAACGCGGGCAATTTCACTCGCGGCTCGCAGCTCATCACGCACGAATTCCTGATGTGGTT
TTCCTCGGCGAAGATGCCGCTGCTGGTGTGGTTCTTCACGTTCCTGATCGCGCTCTCGATCGTCCTCGCG
CTGCTGCTTCACGAGCATGAAGTGCAGATGATCCTGATGCGGATCTATGCGGAGGGATGGAGCTTCATGG
AGTTCAGCCCGCGCAAGATCCTCAACCTAACCTTGCCCTCCGGCCGCGTGATCCCTGCCCCCGTTTCGAT
GATCGCCAGCCACCCTGATGTCGTCATCGCCTGGAACAAGCTGATGCGCGCAATTTGGGGTTCGCTGTTC
ATCTCGCTGTTCGTCGCGGTGCCGCTTTCGGTCTGGTTCATCGACCTCTCGCGCAAGCGCGGCAAGGCGA
TCCTCGAAGAACGCCACCAGCGCGGCGCGATGCTGGTCGACGCCAAGGAGCTTGCCGCCGTGATCAACCA
GCACAACAGCGCCGCGCTTGCCCAGGAGATTGCCGAACGGATGCCCGGCAAGACCATGGACGACGTCATG
AAAATGAGCTTTGCCGAGCGCAAGGCCGCCGGCATCCACCACGTCTACAACATCGCCGGCGTATCGTTTC
CGTGGCGGAGCGAACAGGCTCACACGATCATGATCGGGTCGACCGGGACCGGCAAGACCACGCAGATGCG
GGACATGATCGCGCAGATGCGCGTGCGCCAGGATCGGGCGGTCGTGTTCGATCTTACCGGGGCCTACGTC
GAGGCGTTCTATAACCCCGAGACCGACACGATCCTCAACCCGATGGACGAGCGCTGCCCGAGCTGGTCGC
TGTTCGACGAGGGCAAGAACTACGCCGACTTCACCGCGATCGCATCAGCCATCTTGCCGACCGACGGCGG
CGGCTCGGACCCCTTCTGGATGCTGGGAGCAAGGACATTGTTTGTGCAGACCTGCGTCCAGCTCATGAAG
CTCGGCCAGGCGACCAACGCCGCACTCGCCTACCGGCTGATGATGGCCGACCTTGAAGAGGTCCACGAAC
TGCTTCGCAATACCATTGCCGAGCCGCTGACCGCGCCAGTCGCGGCGCGCATGGCCGAGTCTGTCCGTGC
AGTTCTCAACACCAATGCCCAGGCCTTGTTGTTTATTCCCGAAGGCAAGGAACCCTTCTCGATTTGCGAC
TGGATTCGCCACCAGGACAAGCCGGGCTCGATCCTGTTCATTACCTCTTCGCATAACGAACTGGTGCTCA
ACCGGGCGCTCTTGTCGCTGTGGATGAACCTTGCGGTGCATACCCTGATGCGGCTGCCGCGCACCCGGTC
ATTGCGCACCTGGTTCTTCTTCGACGAAGTCCATGCGCTGCACCGCCTGCCAGCGATCGAAGACGGCTTG
CAGACTGCGCGCGGCTTTGGCGGCGCCTTCGTGCTCGGCATCCATTCCTTCGCCAAGCTAGCCGAGACCT
ATGGCAAGGAAGGCGCGCAGAACCTTGCCTCGCTGGCCCGCACCAAGCTGATCCTGGCAGCGGCCGATCG
CGACACCGCCGAGCACTGCTCGGACTACATTGGTCACCGCGAAGTGCGGATGATGGATGAGGCCTACAGC
TACGGCTATTCCAACATCCGCGACGCCGCGACCATTACCCCGCGCTCGGAAGTGCAGCCGCTGGTGATCC
CCGATGACATCATGCGCCTGCCTTCGCTGCGCGGGTTCCTGGTCTTTCCGGAAGGGTTCGATGCGGCGCG
GATCAGGCTCACCTACAAGGACTACCCCAAGGTCGCAGAGGGCTACATTCTGCGCGAGAACGTCGAGCCT
ATCGAGTTCATCTCCATGCCCAAGGGTGACGATGAAGTCGCCGAGACCGGCGGCCGGGACCGCAGCGGCG
AACCGGAACTGGAGCCGCGCGGCGAAGACCTTGGGCGCGACCCCGCAGTGCCGTTGTCACCGGCGCTCGA
GCCCGACGCCAATGCGCCGGAAATCATGCCCGATGGACCAAATCCTGATCCCAGTGTCGGCAAGCAGATG
GCATTTCGTCTGGAGCAAGCGCCTCAGAACGAACGCACCAATAGCCGCGAGCAGGACCCGAGTCAGAAGG
CTGAAAAGAGTTCCGCGTCCAAGCCTGCCGCGCAGCGCACCGTCGGGTCCCGCGAACTCAATGACCCCGC
CATCCCCGACAAGGAATCTGAGCGCGGCGCGAAGACCGCCAAGGGGATCGAGGACCAATCGCATTCCCGT
GACGACGGACCGGAGCTCTAG
 Primer design