SecReT4
Protein ID: 146275590
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_3983
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]149792..152833 [+]
Producthypothetical protein
Component typeTraI_F
UniProt IDA4XE64
KEGG IDnar:Saro_3983
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 8.4e-86, Aligned region: 7..285
AAA_30 [PF13604], Evalue: 3.7e-47, Aligned region: 469..682
Protein Sequence: 1013 a.a.     [Download]
>gi|146275590|ref|YP_001165751.1| hypothetical protein Saro_3983 [Novosphingobium aromaticivorans DSM 12444]
MHSIASVRSSSGAADYFANDNYYSADEHAEAGVWGGEGARALGLEGQVERDAFEGVLNGRLPDGEMVGQV
EGRRLGLDLTFSMPKSASILALVSGDRRIIDAHLAAVKSTMSQLVEKQFAESRNYERSRSGEPQKTGNLV
YALFAHDTSRALDPQGHIHAVVANLTRDPKGTWKALWNGEIWKNNTTIGQFYHAAFRAQLQKLGYETEAA
GKHGSFEIKGVPAEVIKAFSTRTTEIEAKIAEVGATRLETKKQITLYTRDPKLAVEDRGALVEGWQQRAA
ELGFDGKALVAAAKARAEVEARPSFRETATAAIGEVSTRINAALRTPSPLAVSGAAALFLSAATIKAQHA
TASAIRHLSEREAAFSPQAILASALGFHIKGLEGGAVVQRIGELIRDGHLIPGKSDRLDGHSDLVTTPAA
LAMEQRILDTIERGHGEGRAFMPPEAAMTRLQEAARELGRERAGVDTWQLNEGQLAAGVAILSGGDRFLN
VQGVAGAGKSTLLGALDKVLDAEGVKLVGLAFQNKMVADLRGGGGQGMSADQMREAGIEAYTIARFLNTY
SSAAAAGSGERYEAAKAALANTVIITDESSMVSSRDMLRLVTLAEQLDLAKAPFMGDRQQLSAIEQGKMF
AVSQASGQATVRMDENIRQKNSPLLLAVAGLSNEGHAGLALDLLAAHGRVIEAGPDHVARAAELWLSLEP
DKREATAIFTAGRDDRAEINARVQAGLLKEGTLSGAGVPLATLQSVNATREELRFASTYRVGQVLEARME
VREIGLKAGEYRVSEVRKDGKVVLERDGKRKVIDPDRINPDHRFDRLGLHEEKQIRLHDGETVFWRDKDG
SRDIAKSTYATVLEARAEGIRVELADKRQLVLVPGDPMLRRLDLGYALNAHMAQGMTKPQAIEVISSTQR
NLATQRTQNVLNTRATDDMTVVTNNLEGLKQQLDRTPGNKTSALEVTGKVEVEPRHVNPIDTRQVPELRM
SPELKAKLDAVLGKVAEAPVKQMRPEKTLGLDL
 
Nucleotide Sequence: 3042 bp     [Download]
>gi|146275443|ref|NC_009426.1|:149792-152833 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGCACTCGATCGCCTCCGTCCGGTCGTCGAGCGGCGCTGCCGACTACTTCGCCAACGACAACTACTACT
CGGCCGATGAGCACGCGGAAGCGGGGGTCTGGGGCGGCGAAGGTGCGCGCGCGCTGGGGCTTGAGGGGCA
GGTCGAGCGCGATGCGTTCGAGGGCGTGCTCAATGGGCGGCTGCCCGACGGCGAGATGGTCGGGCAGGTC
GAAGGTCGGCGCCTGGGTCTCGATCTCACCTTCTCGATGCCCAAGTCTGCCTCGATCCTGGCGCTGGTCA
GCGGCGACCGGCGGATCATCGATGCGCACCTGGCGGCGGTCAAATCGACCATGTCGCAGCTTGTCGAAAA
GCAGTTCGCCGAGAGCCGCAACTATGAGCGCAGCCGCAGCGGCGAACCCCAGAAGACCGGTAACCTCGTC
TATGCCCTGTTCGCCCACGATACGAGCCGCGCGCTCGATCCGCAGGGGCATATCCACGCCGTCGTCGCCA
ATCTGACTCGCGATCCCAAGGGCACCTGGAAGGCGCTGTGGAACGGCGAGATCTGGAAGAACAACACCAC
GATCGGCCAGTTCTACCACGCCGCCTTCCGCGCCCAGTTGCAGAAGCTCGGCTACGAAACCGAGGCTGCC
GGCAAACACGGGTCGTTCGAGATCAAGGGCGTGCCCGCCGAGGTGATCAAGGCCTTCTCGACCCGCACCA
CCGAGATCGAGGCGAAGATCGCCGAGGTCGGGGCAACCCGCCTCGAAACCAAGAAGCAGATCACGCTTTA
TACCCGCGATCCCAAGCTGGCGGTCGAGGATCGCGGCGCACTGGTCGAGGGCTGGCAGCAGCGCGCGGCC
GAGCTCGGGTTCGACGGCAAGGCTCTTGTTGCCGCAGCCAAGGCGCGCGCCGAAGTCGAGGCGCGGCCGA
GCTTCCGCGAGACGGCCACGGCCGCGATCGGCGAAGTTTCGACCCGGATCAACGCCGCGCTGCGCACCCC
AAGTCCGCTTGCCGTGAGCGGGGCCGCAGCATTGTTCCTGTCGGCCGCCACCATCAAGGCTCAGCACGCC
ACCGCTTCGGCGATCCGTCATCTCTCCGAGCGCGAGGCAGCGTTCTCGCCGCAGGCAATCCTGGCGAGCG
CGCTGGGGTTCCATATCAAGGGCCTCGAGGGCGGCGCAGTGGTCCAGCGAATTGGCGAGCTCATTCGCGA
CGGGCACCTGATCCCCGGCAAGTCGGACCGGCTCGACGGGCACTCCGATCTCGTGACCACGCCGGCCGCA
CTGGCCATGGAGCAACGCATCCTTGACACCATCGAGCGGGGTCATGGCGAGGGCCGCGCCTTCATGCCGC
CCGAGGCGGCGATGACCCGGCTGCAGGAGGCCGCGCGTGAACTTGGGCGCGAGCGTGCCGGGGTGGACAC
CTGGCAACTCAACGAAGGCCAACTCGCGGCGGGCGTGGCGATCCTCTCAGGCGGCGATCGCTTCCTCAAC
GTCCAGGGCGTCGCCGGTGCGGGCAAATCCACCCTGCTAGGCGCACTCGACAAGGTGCTGGACGCGGAAG
GCGTGAAGCTTGTCGGGCTCGCTTTCCAGAACAAGATGGTCGCTGATCTGCGCGGTGGCGGCGGTCAGGG
CATGTCGGCCGACCAGATGCGCGAGGCGGGGATCGAAGCCTATACCATCGCCCGGTTCCTCAATACCTAC
AGCTCGGCGGCCGCTGCAGGCAGCGGCGAGCGCTACGAGGCAGCGAAGGCTGCGCTCGCCAATACCGTCA
TCATCACCGACGAAAGCTCGATGGTTTCCTCGCGCGACATGCTGCGCCTGGTGACGCTCGCCGAGCAGCT
CGACCTCGCCAAGGCGCCGTTCATGGGCGACCGCCAGCAATTGTCGGCGATCGAGCAGGGCAAGATGTTC
GCGGTCTCGCAGGCCTCTGGTCAGGCGACCGTGCGGATGGATGAGAACATACGCCAGAAGAACTCGCCGC
TTCTCCTCGCAGTTGCGGGGCTCTCGAACGAGGGCCATGCCGGCCTCGCACTTGACCTGCTTGCCGCGCA
CGGCCGCGTAATCGAAGCAGGGCCCGACCATGTCGCCCGCGCCGCCGAGCTGTGGCTCTCGCTCGAACCC
GACAAGCGCGAAGCGACCGCGATCTTCACCGCCGGGCGTGACGATCGCGCCGAGATCAACGCTCGGGTCC
AGGCGGGGTTGCTCAAGGAAGGGACATTGAGCGGCGCGGGCGTGCCGCTGGCGACCCTCCAGAGCGTCAA
CGCCACCCGCGAGGAGCTGCGGTTCGCCTCGACCTACCGGGTGGGTCAGGTGCTTGAGGCGCGGATGGAG
GTGCGCGAGATCGGCCTCAAGGCCGGCGAATACCGGGTGAGCGAGGTGCGCAAGGACGGCAAGGTCGTGC
TCGAGCGCGATGGCAAGCGCAAGGTCATCGATCCTGACCGGATCAATCCCGATCACCGCTTCGACCGGCT
CGGGCTTCATGAAGAGAAGCAGATCCGCCTCCACGACGGCGAAACCGTGTTTTGGCGTGACAAGGACGGG
TCCCGAGACATTGCCAAGTCGACCTACGCCACCGTGCTCGAGGCGCGAGCAGAAGGCATCCGGGTCGAAC
TTGCGGACAAGCGGCAGCTTGTCCTGGTCCCCGGCGATCCGATGCTGCGCCGTCTCGACCTTGGCTATGC
GCTCAACGCTCACATGGCGCAGGGCATGACCAAGCCACAGGCGATCGAGGTCATCTCTTCGACCCAGCGC
AACCTTGCCACCCAGCGCACGCAGAACGTCCTCAATACCCGCGCCACTGACGACATGACCGTCGTCACCA
ACAACCTCGAAGGCCTGAAACAGCAACTCGACCGCACGCCCGGCAACAAGACCTCAGCGCTCGAAGTCAC
CGGTAAGGTCGAGGTTGAGCCGCGCCATGTGAACCCGATCGATACCCGGCAGGTGCCCGAACTCCGCATG
AGCCCCGAGCTCAAGGCCAAGCTCGACGCAGTGCTCGGCAAGGTGGCGGAGGCGCCGGTGAAGCAGATGC
GCCCGGAAAAGACGCTGGGGCTCGACCTGTGA
 Primer design