SecReT4
Protein ID: 146275601
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_3995
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]163015..164469 [-]
ProductTraH family protein
Component typeTraH_F
UniProt IDA4XE75
KEGG IDnar:Saro_3995
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.9e-119, Aligned region: 42..398
Protein Sequence: 484 a.a.     [Download]
>gi|146275601|ref|YP_001165762.1| TraH family protein [Novosphingobium aromaticivorans DSM 12444]
MRARRFARRLHGASRRALGTVLGAAVLLASPTPASAGVEGEMQSFMSDMGVQANVTGPSAYQGQSAGYYS
MGSVWSRFPQKNIQPFNLQLPHARAGCGGIDLFAGSFSFINTAELVAMLKATANNALGFAFKLAIDTISP
EIGKVMDELAQKVQQMNQMNISSCETAQALVGGLWPKSDTASSVICEAIANSQGAVSDWARARQQCNNGG
QREALKSANSDPDMKEQAGMPNNYTWAALGKKYGGFDTQFREFLMTLVGTVIYDPAGNGGKPRVQFIGPA
DPALISAMLDGTSSTPHKYWSCGGDSAKCMAPSEIDMVIGPNAAIKARVRTLIESMALKVRDPGASLTPA
EIQLLGMASVPVYKIITVSAAAEFGISAQEINDLSEIVAVDLVTTMTMRFIDMAVNARSDFNGADADSLR
EWREGLYETRRNFLGIAARTSQRFDQTFALIQRTQMLEKTLRTQLSPQMSAALRFSRTLGSQVQ
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c164469-163015 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGCGCGCCCGTCGCTTCGCCCGCCGCCTCCATGGAGCCTCGCGCCGCGCACTTGGCACAGTCCTCGGTG
CCGCGGTTCTGCTCGCTTCGCCCACACCCGCCTCGGCCGGGGTCGAAGGCGAGATGCAGAGCTTCATGTC
CGACATGGGCGTCCAGGCCAATGTCACCGGTCCCAGCGCCTACCAGGGCCAGTCGGCGGGCTATTATTCG
ATGGGCTCGGTCTGGTCGCGCTTCCCGCAAAAGAACATCCAGCCCTTCAACCTCCAGTTGCCCCACGCGC
GCGCCGGGTGCGGCGGCATCGACCTCTTTGCCGGGTCGTTCTCGTTCATCAACACCGCCGAACTTGTCGC
CATGCTGAAAGCGACCGCGAACAACGCGCTCGGCTTTGCCTTCAAACTCGCGATCGACACGATCTCGCCC
GAGATCGGCAAGGTCATGGATGAGCTGGCGCAGAAGGTTCAGCAGATGAACCAGATGAACATCTCGTCCT
GCGAGACCGCGCAGGCGCTGGTCGGCGGCCTCTGGCCGAAGAGCGATACGGCGAGTTCGGTCATCTGCGA
GGCGATCGCCAACAGTCAGGGCGCGGTCTCCGACTGGGCCCGCGCGCGCCAGCAGTGCAACAACGGCGGC
CAGCGCGAAGCCTTGAAAAGCGCCAATTCCGACCCGGACATGAAGGAACAGGCCGGGATGCCCAACAATT
ACACCTGGGCGGCATTGGGCAAGAAATACGGTGGGTTCGACACCCAGTTCCGCGAGTTCCTGATGACCCT
CGTCGGGACCGTGATCTACGATCCGGCCGGTAATGGCGGCAAGCCGAGGGTCCAGTTCATCGGCCCGGCC
GACCCGGCGCTGATCAGCGCCATGCTCGACGGCACCTCTTCCACCCCGCACAAATACTGGAGCTGCGGCG
GCGATAGCGCCAAGTGCATGGCGCCGAGCGAGATCGACATGGTGATCGGGCCTAATGCAGCGATCAAGGC
GCGGGTGCGCACGCTGATCGAGAGCATGGCCTTGAAAGTGCGCGATCCCGGCGCCTCGTTGACCCCGGCC
GAGATCCAGCTCCTCGGCATGGCGAGCGTGCCGGTCTACAAGATCATCACCGTGAGCGCAGCGGCCGAGT
TCGGCATCTCCGCGCAGGAGATCAACGACCTTTCCGAAATAGTCGCGGTCGATCTCGTCACCACCATGAC
CATGCGGTTCATCGACATGGCAGTGAACGCGCGTTCGGACTTCAACGGGGCTGATGCGGATAGCTTACGC
GAATGGCGCGAGGGGCTTTACGAGACCCGGCGCAATTTCCTCGGGATCGCGGCGCGCACCTCGCAGCGCT
TCGACCAGACCTTTGCGCTGATCCAGCGCACGCAGATGCTCGAAAAGACCCTGCGTACCCAGCTCTCGCC
CCAGATGTCGGCCGCGCTGCGCTTTTCGCGCACGCTCGGCAGCCAGGTCCAGTAA
 Primer design