SecReT4
Protein ID: 146275602
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_3996
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]164469..165281 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDA4XE76
KEGG IDnar:Saro_3996
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.6e-69, Aligned region: 48..259
Protein Sequence: 270 a.a.     [Download]
>gi|146275602|ref|YP_001165763.1| hypothetical protein Saro_3996 [Novosphingobium aromaticivorans DSM 12444]
MNHRQCIALLAASSVALTGTAPLRASEGDGVEVRQSEDALYCKERKLGTWFYCEKPKEEPRKAAAAQPPA
RERLAAIGTQLEELKARAILEPSPENVTAYVRFQREQLDRSSMFADVWQRALWQDPGLDYTLQRPVSTLG
KRAWIDERKTDRDRVMANLSQRYGVFYFFASSCGACDIFSPILKAVSDKYGLAVLAVSTDGGPSSTFPGY
MVDSGQYEKLGLGTDRQVPALVLFDSVTKQPMPIGYGILSQDEIMDRVFQLTQVKVGSDY
 
Nucleotide Sequence: 813 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c165281-164469 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGAACCACCGCCAATGCATTGCCCTGCTTGCCGCCTCCAGCGTCGCGCTTACCGGGACCGCACCGCTGC
GCGCCTCCGAGGGCGACGGTGTCGAGGTGCGGCAGTCCGAGGACGCGCTCTACTGCAAGGAGAGGAAGCT
CGGCACCTGGTTCTACTGCGAGAAGCCCAAGGAGGAGCCGCGCAAAGCTGCTGCTGCGCAGCCACCAGCG
CGCGAGCGACTGGCCGCAATCGGGACCCAGCTTGAAGAACTGAAGGCGCGCGCGATCCTCGAGCCGAGCC
CGGAGAACGTCACCGCCTATGTCCGCTTCCAGCGCGAACAGCTCGACCGCTCCTCGATGTTCGCCGACGT
CTGGCAGCGCGCGCTGTGGCAGGATCCCGGGCTCGACTACACGCTGCAGCGCCCGGTCTCGACGCTCGGC
AAGCGCGCCTGGATCGACGAGCGCAAGACCGACCGCGACCGGGTCATGGCCAATCTCTCGCAGCGCTACG
GGGTGTTCTACTTCTTCGCCTCGAGCTGCGGCGCCTGCGACATCTTCTCGCCGATCCTCAAAGCCGTCTC
GGACAAGTACGGCCTCGCGGTGCTCGCGGTCTCCACCGATGGCGGACCTTCCTCGACCTTCCCCGGCTAC
ATGGTCGACAGCGGGCAATACGAGAAGCTCGGGCTTGGCACCGACCGCCAGGTGCCCGCGCTGGTGCTGT
TCGATTCAGTCACCAAGCAGCCGATGCCGATCGGCTACGGAATCCTCAGCCAGGACGAGATCATGGACCG
CGTCTTCCAGCTGACGCAGGTCAAGGTGGGGAGCGACTACTGA
 Primer design