SecReT4
Protein ID: 146275604
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_3998
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]165669..167783 [-]
Productmating pair stabilisation TraN
Component typeTraN_F
UniProt IDA4XE78
KEGG IDnar:Saro_3998
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.8e-76, Aligned region: 408..654
Protein Sequence: 704 a.a.     [Download]
>gi|146275604|ref|YP_001165765.1| mating pair stabilisation TraN [Novosphingobium aromaticivorans DSM 12444]
MRAPRLAGFALAGMVLLAAAGAQGQVYIPPPDDLVEPQPPLPPAIDPGVPAPAPPPPSAPATMTVDEAKA
EARATGSSVRGAYQGITDAPGAAGQIPGYQAEYPGLTQYYDNPGNMYADGAAAGVNSNAYRTANSTTRPT
VDVTRADLSRANTVTDDPNAYLSGMSADGSTGNCVPLPPSPGTTNTAEWTCNVGSSVVEQPKTCTRSLTV
APWNETLYQYLCVTAPGFPGCASLEGNALCRKTGTFPVPDYNLTVDYYDCDAGVSDPNVYLMGTVAKPPP
ADAFQVVSNVYRCNNEGITDALTFDPVTGFPVQYVSGLQQCGAISAEPSCTQTTASAAGLTDRQLCKTWD
FIGDPFGGGGYLTCLEPASLEAVYSCSTNVAGIVPESSVSKWFTQVWTDNACSVDLGTCTLAAETCTAPN
ETRLIDGVPVTRACWETAKTYQCQTVVGGGNDCGKLDATPGCMFDHETCLDDPPSGDGSCKVAERVYKCP
IPGSTSQPAQYICGDDVYCVNGDCEPIVREASDEFKDAVVALNALGQANSEFDESTLTLFKGTAESCAHK
VFGLANCCSGKGVPLLVPLLCSPAEVLLDQKDDAGLCHKIGTYCSSSFLGICLSKRDVYCCFLSKISRIL
QEQGRPQIGKTWGTPKKPVCDGFTIFEFQQLDLSVMDFSEIYAEFVDAAKLPDEAATLIEIQAKIEAYYA
AHKP
 
Nucleotide Sequence: 2115 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c167783-165669 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGCGCGCGCCGCGCCTTGCTGGATTTGCGCTTGCCGGGATGGTGCTGCTCGCCGCGGCCGGCGCACAAG
GACAGGTCTACATCCCCCCGCCCGACGATCTGGTCGAGCCGCAACCGCCGCTCCCGCCCGCGATTGATCC
CGGCGTGCCCGCTCCCGCCCCGCCGCCTCCTTCCGCGCCTGCCACCATGACCGTGGACGAGGCCAAGGCC
GAGGCTCGGGCGACCGGATCGAGCGTGCGCGGCGCCTACCAGGGGATCACCGATGCCCCGGGTGCGGCCG
GGCAGATACCGGGGTATCAGGCGGAATATCCCGGACTCACCCAGTATTACGACAATCCCGGCAACATGTA
CGCCGATGGGGCGGCGGCCGGCGTGAATAGCAATGCCTACCGCACCGCCAATTCGACCACGCGGCCGACC
GTCGATGTCACCCGCGCCGACCTGTCCCGCGCCAACACCGTGACCGACGATCCCAATGCCTACTTGTCTG
GCATGAGCGCGGACGGGTCGACCGGCAATTGCGTCCCGCTGCCGCCGAGTCCGGGGACCACCAACACTGC
CGAATGGACCTGCAATGTCGGCTCGAGCGTGGTCGAACAGCCCAAGACCTGCACCCGCAGTCTCACCGTC
GCGCCATGGAACGAGACGCTCTACCAGTACCTCTGCGTCACGGCCCCTGGCTTTCCGGGCTGCGCCTCGC
TTGAGGGCAACGCCCTGTGCCGCAAGACCGGGACCTTCCCTGTTCCCGACTATAACCTCACGGTCGACTA
CTACGACTGCGACGCAGGCGTCAGTGATCCCAACGTCTACCTCATGGGCACGGTGGCCAAACCGCCGCCG
GCGGACGCCTTCCAGGTCGTGAGCAACGTCTATCGCTGCAACAACGAAGGGATCACCGATGCGCTGACCT
TTGATCCCGTGACGGGTTTTCCCGTCCAATATGTGAGCGGGCTTCAGCAGTGCGGGGCGATATCGGCGGA
GCCGAGCTGTACCCAAACCACCGCCTCCGCGGCAGGCCTCACCGACCGCCAGCTCTGCAAGACCTGGGAT
TTCATCGGCGATCCGTTCGGGGGAGGGGGCTACCTCACTTGCCTTGAGCCCGCTTCGCTAGAAGCGGTCT
ATTCGTGCAGCACCAATGTCGCCGGCATCGTGCCCGAAAGCTCGGTATCGAAGTGGTTCACCCAAGTCTG
GACCGACAATGCCTGCTCGGTCGATCTTGGCACCTGCACCCTCGCTGCCGAGACCTGCACTGCCCCCAAT
GAAACCCGCCTGATCGATGGCGTGCCGGTCACGCGGGCCTGCTGGGAGACGGCGAAGACCTACCAGTGCC
AGACCGTGGTGGGCGGCGGCAACGACTGCGGCAAGCTCGATGCAACCCCCGGCTGCATGTTCGACCACGA
GACCTGTCTCGACGATCCGCCCAGCGGAGATGGTTCGTGCAAGGTCGCCGAGCGTGTCTACAAGTGCCCG
ATCCCGGGATCGACGAGCCAGCCTGCGCAGTACATCTGCGGGGACGACGTCTACTGCGTCAATGGCGACT
GCGAGCCGATCGTTCGCGAGGCCTCCGACGAGTTCAAGGACGCGGTCGTGGCGCTGAACGCGCTCGGACA
GGCCAATTCCGAGTTCGACGAAAGCACGCTGACGCTGTTCAAGGGCACCGCCGAGAGTTGTGCGCACAAG
GTCTTCGGTCTCGCCAACTGCTGCTCGGGGAAGGGCGTCCCGCTCCTCGTTCCGCTGCTGTGCAGCCCGG
CCGAGGTGCTGCTCGATCAGAAGGACGATGCAGGGCTCTGCCACAAGATTGGCACTTACTGCTCGTCGAG
CTTCCTTGGCATCTGTCTTTCCAAGCGCGATGTCTATTGCTGCTTCCTCTCGAAGATCAGTCGGATCCTC
CAGGAGCAGGGCCGGCCCCAGATCGGCAAGACATGGGGAACGCCGAAGAAGCCCGTCTGCGACGGCTTCA
CCATTTTCGAGTTCCAGCAGCTCGACCTCTCGGTGATGGATTTTTCCGAAATCTACGCGGAGTTCGTCGA
TGCGGCGAAGCTCCCCGACGAAGCCGCCACGCTCATCGAAATCCAGGCAAAGATCGAGGCCTATTATGCC
GCGCACAAGCCCTGA
 Primer design