SecReT4
Protein ID: 146275605
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_3999
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]167785..168549 [-]
Producthypothetical protein
Component typeTrbC_F
UniProt IDA4XE79
KEGG IDnar:Saro_3999
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 7.8e-29, Aligned region: 120..232
Protein Sequence: 254 a.a.     [Download]
>gi|146275605|ref|YP_001165766.1| hypothetical protein Saro_3999 [Novosphingobium aromaticivorans DSM 12444]
MTFARTLLKPHLAGIAGFLALTAVSAALAQTLDGIDLKAIKDRATEATADAQTLVDAVAGKGEAHRAEAE
TLREQGLASVASIDPASLPKGPDGAVDFDELLAGAAANTRAPMGEGPMFMVFASLSMPGASLTRLIADTT
KAGGVVVFRGFPGGSTKAFAEGLKRVVTDEGQEAHLAIDPRLFRAFKVEAAPTFVAAGREYELCDGLDCT
SATPDHDRLTGNVTVEFALESFAGGRGPGAGVARIALAQLNKGH
 
Nucleotide Sequence: 765 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c168549-167785 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGACCTTCGCGCGCACCTTGCTTAAACCCCACCTCGCAGGAATCGCTGGCTTCCTCGCGCTTACGGCTG
TCTCGGCAGCGCTCGCGCAAACGCTAGACGGCATCGACCTCAAGGCCATCAAGGACCGGGCAACCGAGGC
GACAGCCGATGCCCAGACCTTGGTCGATGCGGTTGCCGGCAAGGGCGAGGCGCACCGCGCCGAGGCCGAG
ACCTTGCGCGAACAAGGCCTCGCTTCCGTCGCTTCGATCGATCCCGCGAGCCTTCCCAAGGGCCCGGATG
GCGCGGTCGACTTCGACGAACTGCTCGCCGGCGCCGCGGCCAATACCCGCGCGCCGATGGGCGAGGGGCC
GATGTTCATGGTCTTTGCCAGCTTGTCGATGCCTGGGGCCTCGCTCACCCGGCTGATCGCCGACACGACC
AAGGCCGGCGGCGTGGTGGTGTTCCGCGGCTTTCCCGGAGGCAGCACAAAAGCCTTTGCCGAGGGCCTCA
AGCGCGTTGTGACCGACGAGGGCCAAGAAGCCCATCTCGCGATCGACCCGCGCCTGTTCCGCGCCTTCAA
GGTCGAGGCTGCGCCGACCTTCGTCGCCGCGGGCCGCGAGTACGAGCTCTGCGACGGGCTCGACTGCACC
AGCGCCACTCCCGACCACGACCGGCTCACCGGCAATGTCACAGTCGAGTTCGCGCTCGAGAGTTTTGCAG
GTGGCCGCGGGCCCGGCGCCGGCGTCGCGCGCATCGCGCTCGCCCAGCTCAACAAGGGTCATTGA
 Primer design