SecReT4
Protein ID: 146275606
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4000
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]168558..169580 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDA4XE80
KEGG IDnar:Saro_4000
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 9.7e-84, Aligned region: 34..339
Protein Sequence: 340 a.a.     [Download]
>gi|146275606|ref|YP_001165767.1| TraU family protein [Novosphingobium aromaticivorans DSM 12444]
MTRLGRKFAALLAALALAFAVSAPARADTATCHGKFINPITDVCWSCLFPLSIGGLSIWKGSRPDPKNPS
FPLCACGSPIPRIGISVGFWEPVRLVDVTNKAWCFPNLGGIRLNPGFAIGNGHVQGRSQIGGKAQNSSQW
QSHYYVYPLLYWMEILTDFLCFEQTTFDVAYVTEIDPLWQDSALTSIINPEVALFSNPIATAACAADCVA
ATAKLPIDQMFWCAGCNGGMYPLNGHVAAHVTPIQASRLVAERMLYKMHREALAWGTMGSKALCHKYLMP
VMRKQQYRLQMTNPISTVKGRYACAPIGATTIIPQTGKGYPVKGEDFGYLVWRKRNCCML
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c169580-168558 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGACGCGGCTCGGCCGGAAATTCGCCGCCTTGCTCGCGGCGCTGGCGCTCGCCTTTGCGGTATCGGCGC
CCGCGCGCGCCGATACCGCCACCTGCCACGGCAAGTTCATCAACCCGATCACCGACGTGTGCTGGTCGTG
CCTGTTCCCACTGTCGATCGGCGGGCTCTCGATCTGGAAGGGCTCGCGCCCCGACCCCAAGAATCCCTCG
TTTCCCTTGTGCGCCTGCGGTTCGCCGATCCCGCGCATTGGTATCTCGGTGGGCTTTTGGGAGCCGGTGC
GGCTTGTCGACGTCACCAACAAGGCCTGGTGCTTTCCCAACCTTGGCGGAATCCGCCTCAACCCCGGCTT
CGCCATCGGCAATGGCCATGTCCAGGGCCGCAGCCAGATCGGCGGCAAGGCGCAGAACAGCTCGCAGTGG
CAGTCGCACTACTACGTCTACCCGCTGCTCTACTGGATGGAGATCCTGACCGACTTCCTTTGCTTCGAGC
AGACCACCTTCGATGTTGCCTATGTCACCGAGATTGACCCGCTCTGGCAGGATTCCGCGCTCACCTCGAT
CATCAATCCGGAAGTCGCGCTGTTCTCGAACCCGATCGCGACCGCGGCGTGTGCGGCCGACTGTGTCGCG
GCGACCGCCAAGCTGCCGATCGACCAGATGTTCTGGTGCGCGGGCTGCAACGGCGGGATGTACCCGCTGA
ACGGCCACGTCGCCGCGCATGTCACCCCGATCCAGGCCTCGCGGCTCGTCGCCGAACGCATGCTCTACAA
GATGCACCGCGAGGCGCTCGCCTGGGGGACGATGGGTTCGAAGGCGCTGTGCCACAAGTACCTGATGCCG
GTGATGAGGAAGCAGCAATACCGGCTGCAGATGACCAACCCGATCTCGACAGTGAAGGGCCGCTACGCCT
GCGCGCCGATCGGCGCGACCACCATCATTCCCCAGACCGGCAAGGGCTACCCCGTCAAGGGTGAGGACTT
TGGCTACCTCGTCTGGCGCAAGCGCAACTGCTGCATGCTGTGA
 Primer design