SecReT4
Protein ID: 146275608
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4002
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]169840..170535 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDA4XE82
KEGG IDnar:Saro_4002
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 231 a.a.     [Download]
>gi|146275608|ref|YP_001165769.1| hypothetical protein Saro_4002 [Novosphingobium aromaticivorans DSM 12444]
MRPFAALIAASGLALLVGWPGISGLRAADYGQMGQTFPIIETDLLTTIETRLRTLEANGGIERMQRQMQE
QAVASVRRPKPVDGMTPASVKREWLFDPSIVTEDDIVDAKGNLIAARGTRVNPLDMVQLSQALVFVDGDN
AAELAWAVKTWSDARAKIIFVSGSPFDAMKPWQRRFYFDQGGTLTAKFGIRHTPAVVSAAGANLKISEVP
LPPAAAAPARAPVLSGGGKVS
 
Nucleotide Sequence: 696 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c170535-169840 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
GTGAGGCCCTTCGCCGCCCTGATCGCCGCAAGCGGCCTTGCCCTGCTGGTCGGTTGGCCGGGCATCTCGG
GCCTGCGTGCTGCCGACTATGGGCAGATGGGTCAGACCTTTCCGATCATCGAGACCGATCTTCTCACCAC
GATCGAGACGCGGCTGAGGACGCTCGAGGCCAATGGCGGGATCGAGCGCATGCAGCGCCAGATGCAGGAA
CAAGCGGTCGCCAGCGTGCGCCGTCCCAAGCCGGTCGATGGCATGACCCCCGCAAGCGTCAAGCGCGAAT
GGCTGTTCGATCCCTCGATCGTCACGGAAGACGACATCGTCGATGCCAAGGGCAACCTGATCGCCGCGCG
CGGCACCCGGGTCAATCCGCTCGACATGGTGCAATTGAGCCAGGCGCTGGTCTTCGTCGATGGTGACAAT
GCGGCCGAGCTGGCCTGGGCGGTGAAAACCTGGAGCGATGCGCGGGCCAAGATCATCTTTGTCTCGGGCT
CGCCGTTCGATGCGATGAAGCCTTGGCAGCGGCGCTTCTACTTCGACCAGGGCGGCACGCTCACCGCCAA
GTTCGGCATCCGCCACACCCCCGCCGTGGTCTCGGCAGCGGGCGCAAATCTCAAGATCAGCGAAGTGCCG
CTACCGCCCGCGGCAGCCGCGCCCGCACGCGCACCCGTTCTCTCTGGCGGAGGCAAGGTGTCATGA
 Primer design