SecReT4
Protein ID: 146275612
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4006
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]171988..174594 [-]
Producttype IV secretion/conjugal transfer ATPase
Component typeTraC_F
UniProt IDA4XE86
KEGG IDnar:Saro_4006
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.2e-57, Aligned region: 30..277
AAA_10 [PF12846], Evalue: 1.7e-53, Aligned region: 476..767
TraG-D_C [PF12696], Evalue: 8.1e-05, Aligned region: 705..766
Protein Sequence: 868 a.a.     [Download]
>gi|146275612|ref|YP_001165773.1| type IV secretion/conjugal transfer ATPase [Novosphingobium aromaticivorans DSM 12444]
MASHGFWDRFLDMLFGESAHPEAERPVLGAPMLSNWLPYRSYDKKHGLFINTDSLGFILELAPMMGADER
SGELLTQFLSDAVPSGCEIQLIHWQSPSVGERIADWVMPRVVAKGVYGRAAMHRARWLRRAAWMSISRDA
PFYLRNTRVILSVGARLSGPIGADTLASVRDSLHGTLQSLSIPARDMGPVELIAFLDDFLCPAVDNADKP
EHYSELDPINVQCVRRDLETQVTPDRIVLQTERFRPTGERQDGAPVIGEVVPDKFDWRFFSVRNLPKQWA
PWDVQKIIGDVINDKLRFGCNVMTVLGLVYQDEEAVASRAGLKVMRTTSLADSRSARFLPQLSEQRDEWQ
YVQAEIRQGRKLAQVYYGVGALSPLGKGDINERMVKSVYKACGWDLIDERYLQVMGLLAAMPLSLPNGLS
ADLKRMKRFKTMLTTTAASIAPLQGEHTGGHIPHVLLIGRRGQPFFWSPFQNAAGNHNVAVFGKSGSGKS
VFLQDVCAAMSGAGAKVIVIDDGRSFEHMVKAFGGAFVEFKLSSGFSLNPFDMIDGEALASDEDGEDYEV
ECLAMLKSIVGQMARQQDRLSDTERGLIDSAVSTVWREKQRHGTIDDVAAALRALPSPYAGDLADAMSPF
LKGGTYGRFFEGACSIDLSAGLTVFELSDLSSKPELRSVALTALMFLTLRVMRDLDRSVPKLTMIDEAWQ
LLGGGQMGQAIETYARTCRKYGGSLITATQSLNDFYKSEGSLAALENSDWSIVLQQKEETINDLAKHQRF
EMDHYTESLLRSLKRNGTEYSDVLIKGPETLAVGRLVLDPYSATLYSSSPRVFSEIEDKVRGGLALPDAI
ERVAFPDFVPPEPGAPDFAEGELAEAAE
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c174594-171988 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGGCCTCGCACGGGTTCTGGGACCGGTTCCTCGATATGCTGTTCGGCGAAAGCGCGCATCCGGAGGCGG
AGCGCCCGGTGCTCGGCGCGCCGATGCTGTCGAACTGGCTGCCCTATCGAAGCTACGACAAGAAGCACGG
CCTGTTCATCAACACGGACTCGCTCGGGTTCATTCTCGAGCTGGCCCCGATGATGGGCGCAGACGAGCGC
AGCGGCGAGCTGCTGACCCAGTTTCTGTCGGACGCCGTGCCCTCGGGCTGCGAGATCCAGCTGATCCACT
GGCAGAGTCCCTCGGTTGGCGAACGCATCGCTGATTGGGTGATGCCGCGCGTGGTCGCCAAGGGGGTCTA
TGGCCGCGCGGCGATGCACCGGGCGCGCTGGCTGCGCCGCGCCGCCTGGATGTCGATCTCGCGCGACGCA
CCGTTTTACCTGCGCAACACCCGGGTGATCCTCTCGGTCGGTGCCCGGCTCAGTGGCCCGATCGGGGCCG
ACACGCTCGCCTCGGTGCGCGACAGTCTTCACGGGACGCTGCAGTCGCTCTCGATCCCGGCCCGCGACAT
GGGACCGGTCGAACTGATCGCCTTCCTCGACGATTTTCTCTGCCCGGCGGTCGATAACGCCGACAAGCCC
GAACACTATTCCGAGCTCGATCCGATCAACGTCCAGTGCGTGCGGCGCGATCTCGAAACCCAGGTCACCC
CTGACCGGATCGTGCTCCAGACCGAGCGCTTCCGCCCCACTGGCGAGCGCCAGGACGGCGCGCCGGTGAT
CGGCGAGGTCGTGCCCGACAAGTTCGACTGGCGCTTCTTCTCGGTGCGCAACCTCCCCAAACAATGGGCG
CCGTGGGACGTCCAGAAAATCATCGGCGACGTCATCAACGACAAGCTGCGCTTCGGCTGCAACGTCATGA
CCGTGCTCGGGCTCGTCTACCAGGACGAGGAAGCGGTCGCCTCGCGCGCGGGCCTCAAGGTCATGCGCAC
CACCAGCCTTGCCGACAGCCGCTCGGCGCGCTTCCTGCCCCAGCTCTCCGAGCAGCGCGACGAATGGCAA
TACGTTCAGGCCGAGATCCGCCAGGGCCGCAAGCTCGCGCAGGTCTACTACGGCGTCGGCGCGCTCTCGC
CCTTGGGCAAGGGCGACATCAACGAGCGCATGGTGAAGTCGGTCTACAAGGCCTGCGGGTGGGACCTCAT
CGACGAGCGCTACCTCCAGGTGATGGGGCTGCTCGCAGCGATGCCGCTGTCGCTCCCCAATGGGCTCTCG
GCTGACCTGAAGCGCATGAAGCGCTTCAAGACCATGCTCACCACCACCGCGGCCTCGATCGCGCCGCTCC
AGGGCGAGCACACCGGCGGGCACATCCCGCACGTTCTGCTCATCGGCCGGCGCGGGCAGCCGTTCTTCTG
GTCGCCGTTCCAGAACGCGGCGGGCAATCACAACGTCGCCGTTTTCGGCAAGTCGGGCTCGGGCAAGTCG
GTATTCCTGCAGGACGTCTGTGCCGCGATGTCCGGCGCGGGGGCCAAGGTCATCGTGATCGATGACGGCC
GCTCGTTCGAGCACATGGTCAAAGCCTTCGGCGGCGCTTTCGTCGAGTTCAAGCTATCCTCTGGCTTCTC
GCTCAATCCCTTCGACATGATCGACGGCGAGGCGCTAGCGAGCGACGAGGACGGCGAGGACTATGAGGTC
GAATGCCTCGCGATGCTCAAATCGATCGTCGGCCAGATGGCGCGCCAGCAGGACCGCTTGTCCGACACCG
AGCGCGGGCTGATCGATTCCGCGGTGAGCACGGTCTGGCGCGAGAAACAGCGCCATGGGACGATTGACGA
TGTTGCCGCGGCGCTGCGCGCGCTGCCTTCGCCCTATGCCGGCGATCTTGCCGATGCGATGTCGCCGTTC
CTAAAAGGCGGCACCTATGGCCGCTTTTTCGAAGGCGCCTGCTCGATCGACCTCTCGGCCGGGCTCACCG
TGTTCGAGCTCTCCGACCTCTCCTCGAAGCCCGAACTGCGCTCGGTCGCGCTGACCGCGCTCATGTTCCT
GACACTTCGGGTGATGCGCGATCTCGACCGCTCGGTGCCCAAGCTGACGATGATCGACGAAGCCTGGCAA
CTCCTTGGCGGCGGGCAGATGGGCCAGGCGATCGAGACCTATGCCCGCACCTGCCGCAAATATGGCGGCT
CGCTGATCACAGCGACCCAGTCGCTCAACGACTTCTACAAGTCGGAAGGTTCGCTCGCCGCACTCGAAAA
CTCGGACTGGTCGATCGTCCTCCAGCAGAAGGAAGAGACGATCAACGATCTCGCCAAGCACCAGCGCTTC
GAGATGGACCATTACACGGAAAGCCTGCTCCGCTCGCTGAAGCGCAACGGGACCGAGTATTCCGACGTCC
TGATCAAAGGCCCCGAGACGCTTGCTGTAGGGCGCCTTGTGCTCGATCCCTATTCGGCGACGCTCTATTC
CTCGAGCCCCCGGGTCTTTTCCGAGATCGAGGACAAGGTGCGCGGCGGCCTGGCGCTCCCCGATGCGATC
GAGCGGGTGGCCTTCCCCGATTTCGTGCCGCCCGAGCCCGGCGCGCCCGACTTTGCCGAGGGCGAGCTTG
CGGAGGCGGCCGAATGA
 Primer design