SecReT4
Protein ID: 146275613
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4007
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]174601..175752 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDA4XE87
KEGG IDnar:Saro_4007
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 9.5e-13, Aligned region: 138..241
Protein Sequence: 383 a.a.     [Download]
>gi|146275613|ref|YP_001165774.1| hypothetical protein Saro_4007 [Novosphingobium aromaticivorans DSM 12444]
MTALSSKHLASLTRAVARRSCGRVSLPRVELSRAEAIQLWQDLVLATAVPRGVLLTPREQALLGKRAWAR
SAGHVALGEAPLSRQSGLAIWRLAIRLGDLAARRSPNPVTRAASIAAIGLAATQLAACTSLFGGNIKGSF
ACSAPGGTCAPSTVIDDQALSVIQNARPMTPAGPYIRQPAAAKPVTASYTPSGSGRITSAGGGMVHRERR
VLKVVFPSFVDGGGNLHEPRIIHAVVDNGAWMELSSGEPNIGEQVEGRAVSLASAAFVPAPVPVAPIAQD
AGSPTPKAIDAAPSGPPRPEAVAAARAKGAALQSGNAIEAIQAQVQARLAPTAKAHVPAAAVRAAPSSAV
PTPAPASASAVSAAPAATKPANGPAAFPAKVEE
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c175752-174601 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
GTGACCGCGCTCAGCTCCAAGCATCTTGCGAGCCTCACGCGCGCAGTCGCGCGGCGCTCTTGTGGGCGAG
TCTCGCTGCCGCGGGTGGAGCTCAGCCGCGCCGAAGCAATCCAGCTGTGGCAGGATCTCGTCCTTGCCAC
TGCGGTTCCGCGAGGCGTGCTGCTCACGCCTCGCGAACAGGCATTGCTGGGCAAGCGCGCGTGGGCGCGC
TCGGCGGGCCATGTCGCGCTTGGTGAGGCTCCGCTGTCGCGCCAATCGGGCCTCGCCATCTGGCGGCTCG
CGATCCGGCTTGGGGATCTTGCGGCGCGGCGATCGCCAAACCCCGTCACCCGGGCTGCAAGCATCGCGGC
CATCGGACTCGCGGCTACCCAGCTCGCCGCCTGCACCTCGCTGTTCGGCGGCAACATCAAGGGCAGCTTT
GCCTGCAGCGCACCAGGCGGGACCTGCGCGCCTTCGACGGTGATCGACGACCAGGCGCTGTCGGTGATCC
AGAATGCCCGGCCGATGACCCCGGCAGGGCCGTACATCCGCCAGCCCGCCGCCGCCAAGCCGGTTACTGC
GTCGTACACGCCGTCGGGTTCGGGCCGCATCACCTCGGCCGGCGGCGGCATGGTCCACCGCGAGCGCCGC
GTGCTCAAGGTGGTGTTCCCCTCTTTCGTCGATGGTGGTGGCAATCTCCACGAACCGCGGATCATCCACG
CAGTGGTCGACAACGGCGCCTGGATGGAGCTGTCCTCGGGCGAGCCCAATATCGGCGAGCAGGTCGAGGG
CAGGGCAGTTAGCCTCGCGAGCGCGGCATTCGTGCCGGCACCGGTACCCGTCGCCCCGATCGCCCAGGAC
GCTGGGTCACCCACTCCCAAAGCAATAGATGCCGCGCCTTCCGGGCCGCCGCGCCCCGAGGCCGTTGCGG
CGGCGCGCGCCAAGGGTGCCGCGCTCCAGTCGGGCAATGCGATCGAGGCGATTCAGGCTCAGGTGCAGGC
GCGTCTCGCGCCCACTGCGAAAGCGCACGTCCCGGCAGCAGCGGTACGTGCGGCGCCCAGTAGTGCGGTG
CCGACCCCAGCTCCGGCTTCCGCCTCGGCGGTCAGCGCCGCTCCGGCGGCGACCAAGCCCGCCAATGGCC
CCGCCGCCTTTCCGGCCAAGGTCGAGGAGTAA
 Primer design