SecReT4
Protein ID: 146275615
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4009
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]176656..178032 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA4XE89
KEGG IDnar:Saro_4009
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.5e-35, Aligned region: 248..454
Protein Sequence: 458 a.a.     [Download]
>gi|146275615|ref|YP_001165776.1| TraB pilus assembly family protein [Novosphingobium aromaticivorans DSM 12444]
MDWKNPFRKGPKALDGPATHPGSGDASPLGDAIVANEAVRKKQMLLLGAGGLAALVIGSSWIFAGDHKSS
DASVKRQVADVSVDEMVNKNMAEKEWRAQSEAQMMSMDTNMRALAARAQRADQLEAQLAQGQAAQSTSGG
GISPDTERVLSAYQNENEQLKAALAAARQSPVMGAGATPVGPNALYGRTSPPSYQTAPSTPAGQAAMAAA
GLPAGRGSEVSLVSFNEGASGTGSPVPKGNTVFTDSANYLPPNSIAVAKVIVGVDAAAGVQSQTDPLPVV
LRITGPARSVYDNGRLLTTNIAGCLVNGAARGDLSSEKVYVKLQRMTCPQPNGRYAVSDVKGFIAFGGKT
GVRGRVVSREGSLIGQAFLAGLAGGFGRGFAANTNSTLTGTNVNVNGQRQKLGTGDILEGGLGEGIATSG
DMVSKYLIERAEQYQPVIEMPTGIDVEIVFLEGVFING
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c178032-176656 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGGACTGGAAGAACCCGTTCCGCAAAGGCCCCAAGGCGCTCGACGGTCCCGCAACCCACCCTGGAAGTG
GTGACGCCTCGCCGCTCGGCGATGCAATCGTGGCCAATGAGGCGGTCAGGAAGAAGCAGATGCTGCTGCT
CGGCGCTGGCGGTCTTGCCGCGCTTGTCATCGGCTCCTCGTGGATCTTCGCCGGCGATCACAAGAGCAGC
GACGCCAGCGTCAAGCGGCAGGTCGCCGACGTCTCGGTCGACGAGATGGTCAACAAGAACATGGCCGAGA
AGGAGTGGCGTGCCCAGTCCGAGGCGCAGATGATGTCGATGGACACCAACATGCGCGCGCTCGCTGCCCG
TGCGCAGCGGGCCGACCAGTTGGAAGCGCAGCTGGCCCAGGGTCAGGCAGCGCAGAGCACGTCAGGCGGC
GGGATATCTCCCGACACCGAGCGGGTGCTTTCCGCCTACCAGAACGAGAATGAGCAGTTGAAGGCAGCGC
TCGCAGCCGCGCGCCAGTCGCCGGTCATGGGTGCCGGCGCGACACCGGTCGGACCCAACGCGCTTTACGG
GCGGACCAGCCCACCGAGCTACCAGACCGCGCCCAGCACGCCTGCCGGGCAAGCCGCAATGGCCGCGGCG
GGACTCCCGGCAGGGCGCGGGAGCGAGGTCAGCCTGGTCTCGTTCAACGAGGGCGCAAGCGGAACCGGAA
GCCCGGTCCCCAAGGGCAACACTGTCTTCACCGACAGCGCCAATTACCTGCCGCCGAACTCGATCGCGGT
CGCCAAGGTCATAGTCGGGGTCGATGCGGCCGCCGGCGTCCAGAGTCAGACCGATCCCCTGCCGGTCGTG
CTGCGCATCACCGGCCCTGCGCGCTCGGTCTACGACAACGGGCGGCTGCTCACGACCAATATCGCCGGAT
GCCTGGTCAACGGCGCGGCGCGCGGCGACCTCTCGAGCGAGAAGGTCTACGTCAAGCTGCAGCGCATGAC
CTGCCCGCAGCCCAATGGCCGTTACGCGGTCTCGGACGTCAAGGGCTTCATCGCCTTCGGCGGCAAGACC
GGGGTCAGGGGGAGGGTGGTCAGCCGGGAAGGTTCGCTGATCGGCCAGGCCTTCCTTGCCGGTCTCGCCG
GCGGCTTTGGCCGCGGCTTTGCCGCCAACACCAATTCGACGCTCACCGGAACAAACGTCAACGTCAATGG
GCAGCGCCAGAAGCTCGGCACCGGCGACATCCTCGAGGGCGGGCTCGGCGAAGGCATCGCCACCTCGGGC
GACATGGTCAGCAAGTACCTGATCGAGCGGGCCGAACAGTACCAGCCCGTGATCGAGATGCCGACCGGGA
TCGATGTCGAAATCGTGTTTCTCGAAGGCGTGTTCATCAACGGGTGA
 Primer design