SecReT4
Protein ID: 146275616
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4010
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]178032..178826 [-]
Producthypothetical protein
Component typeTraK_F
UniProt IDA4XE90
KEGG IDnar:Saro_4010
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 9.4e-43, Aligned region: 34..256
Protein Sequence: 264 a.a.     [Download]
>gi|146275616|ref|YP_001165777.1| hypothetical protein Saro_4010 [Novosphingobium aromaticivorans DSM 12444]
MAELGWGAIGVGSVLAGRPYAINGRPVGAALICFGALCLAAPAMADQSIPAADNGTVACVASAKDLTRIS
LAGDQFASVSKISTGNPAEDFKIVNEPVRGDIYISVPDGFTKPNLSFFGTTRKGYVYKFLCQVRGNDAEQ
VFVTNTAIKTEAARDWEVRSSPEDAAVRLAQAMYRSETIEGFEIRQSVLEPVAVGKLEVQQVGEYRGADL
KGLILKVRNTGAKPLTLDENLLAARGSVAFMTPVSELAPGQAAAVYLIQSNGGQ
 
Nucleotide Sequence: 795 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c178826-178032 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGGCCGAACTGGGTTGGGGCGCGATCGGGGTGGGCAGCGTGCTCGCCGGACGGCCCTATGCAATCAATG
GCCGCCCGGTTGGCGCCGCGCTCATCTGCTTCGGTGCGCTGTGCCTTGCCGCACCCGCCATGGCCGACCA
GAGCATTCCCGCTGCTGACAATGGTACGGTCGCCTGTGTCGCCTCGGCGAAGGACCTCACCCGGATCAGC
CTTGCGGGAGACCAGTTCGCCTCGGTCTCGAAGATCAGCACCGGCAACCCGGCCGAGGACTTCAAGATCG
TCAACGAGCCCGTGCGCGGGGACATCTACATTTCGGTGCCCGATGGCTTCACCAAGCCCAACCTCTCGTT
CTTCGGCACGACCCGAAAGGGCTACGTCTACAAGTTCCTCTGCCAGGTCCGCGGCAACGACGCCGAGCAG
GTCTTCGTCACCAACACGGCGATCAAGACCGAGGCCGCGCGCGATTGGGAAGTGCGCTCTTCGCCCGAGG
ATGCCGCCGTGCGCCTCGCGCAAGCCATGTATCGCAGCGAGACCATCGAAGGCTTCGAGATCAGGCAAAG
CGTGCTCGAGCCGGTCGCGGTCGGCAAGCTCGAGGTCCAGCAGGTCGGCGAATACCGCGGCGCTGACCTC
AAGGGACTGATCCTCAAGGTCCGCAACACCGGCGCAAAGCCGCTCACTCTCGATGAGAACCTGCTCGCCG
CGCGCGGCAGCGTCGCCTTCATGACCCCGGTGAGCGAGCTCGCGCCCGGCCAGGCGGCCGCTGTCTACCT
CATCCAATCGAATGGAGGCCAGTGA
 Primer design