SecReT4
Protein ID: 146275617
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4011
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]178826..179449 [-]
ProductTraE family protein
Component typeTraE_F
UniProt IDA4XE91
KEGG IDnar:Saro_4011
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.1e-69, Aligned region: 1..183
Protein Sequence: 207 a.a.     [Download]
>gi|146275617|ref|YP_001165778.1| TraE family protein [Novosphingobium aromaticivorans DSM 12444]
MDLSISHGQAQRLLKQRNLLAITATGLFALSVVLTFTAAHRDREVVLQPVLAKPLTLSSSHIDKDYLELV
TRDAALLTLNRSPSNLQYWMDSILAITDPRTHGRMKAELMKIFNEQNGSNVSQFFTIENLSVDPEALTSE
VNGVLHTVVGSKEVTSEARTFRYVWSYSGVSLKLAGFGRVTKDPSGKVIDAKGAGSAQSDNSDGGEA
 
Nucleotide Sequence: 624 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c179449-178826 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
ATGGACCTCTCGATTTCTCACGGCCAGGCGCAGCGGCTCTTAAAGCAGCGCAACCTCCTCGCGATCACCG
CGACCGGGCTGTTTGCCCTGAGCGTGGTGTTGACGTTCACCGCCGCGCACCGCGACCGCGAAGTGGTGCT
GCAGCCGGTGCTGGCGAAGCCGCTGACGCTGTCCTCGAGCCACATCGACAAGGATTACCTTGAGCTCGTC
ACGCGCGATGCCGCGCTGCTGACACTCAACCGCTCGCCGTCCAACCTGCAGTACTGGATGGATTCGATCC
TGGCGATCACCGATCCCAGAACCCACGGCCGGATGAAGGCCGAACTGATGAAGATCTTCAACGAGCAGAA
CGGCTCGAATGTCTCGCAGTTCTTCACGATCGAGAACCTCTCTGTCGATCCCGAGGCACTGACCAGCGAG
GTCAACGGCGTGCTGCACACGGTGGTCGGCTCCAAGGAGGTGACCTCCGAAGCCCGGACCTTCCGCTACG
TGTGGAGCTACTCGGGCGTCAGCCTCAAGCTCGCCGGGTTCGGGCGCGTGACCAAGGATCCGTCGGGCAA
GGTCATCGACGCCAAGGGCGCGGGCAGCGCGCAATCAGACAATAGCGACGGGGGAGAGGCGTGA
 Primer design