SecReT4
Protein ID: 146275618
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4012
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]179463..179756 [-]
ProductTraL family protein
Component typeTraL_F
UniProt IDA4XE92
KEGG IDnar:Saro_4012
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 8.1e-37, Aligned region: 6..96
Protein Sequence: 97 a.a.     [Download]
>gi|146275618|ref|YP_001165779.1| TraL family protein [Novosphingobium aromaticivorans DSM 12444]
MSFMNRYTVPAHLDDPELIGFWTLDEFLAMIVPFAWGILSQHIFIGLCSSVLAWWGLRKLKAGRAVSWII
HSAYWYLPGAFMGLRATPPSHLRLMAG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c179756-179463 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
GTGTCGTTCATGAATCGCTACACGGTTCCCGCGCATCTCGATGATCCGGAGCTGATCGGGTTTTGGACAC
TCGATGAGTTTCTCGCGATGATCGTTCCCTTCGCCTGGGGCATCCTGTCTCAACATATTTTCATCGGTCT
ATGTTCAAGCGTGCTGGCCTGGTGGGGATTGCGCAAGTTGAAGGCGGGACGAGCCGTCTCGTGGATCATT
CATTCGGCCTACTGGTACCTGCCGGGTGCCTTTATGGGGCTGAGAGCGACGCCGCCCTCCCATCTTCGCC
TGATGGCGGGCTGA
 Primer design