SecReT4
Protein ID: 146275622
T4SS name [ID]Tra_F [528]
Gene symbol-
Locus tagSaro_4016
StrainNovosphingobium aromaticivorans DSM 12444
Repliconplasmid pNL1 [GenBank: NC_009426] [Browse all T4SS(s) in this replicon]
Location [Strand]181689..182408 [-]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDA4XE96
KEGG IDnar:Saro_4016
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 239 a.a.     [Download]
>gi|146275622|ref|YP_001165783.1| lytic transglycosylase, catalytic [Novosphingobium aromaticivorans DSM 12444]
MSRFAPSAIAASGGDGPVEVALRAHLQGISQPVYIIDKIGKGASASQNPLSCPGNGYLQTWWLPAEVEKR
RATYFEAMSQIACENGLPASLLDAVVAQESGYKAWAISRAGAMGMMQVMPGTARHLELWNPWDALANMRA
GARYLRQQLDRFERVDLALAAYNAGPERRSLTLGYIPAIPETRNYVRTITTNWLRLTQLNRPDSSSLARA
TAASTAVWASGYREVSLVTYDGTNSANPI
 
Nucleotide Sequence: 720 bp     [Download]
>gi|146275443|ref|NC_009426.1|:c182408-181689 Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence
TTGTCTCGCTTCGCTCCTTCTGCCATTGCGGCCAGTGGCGGAGATGGTCCTGTCGAGGTTGCGCTACGCG
CTCATTTGCAAGGTATCAGCCAACCTGTCTATATAATTGATAAAATTGGCAAAGGAGCCAGCGCAAGCCA
GAACCCGCTGTCTTGTCCTGGGAATGGTTACCTCCAGACATGGTGGTTGCCGGCCGAGGTGGAGAAACGC
CGAGCAACGTACTTTGAAGCGATGTCGCAAATCGCCTGCGAGAATGGCCTGCCCGCCAGCTTGCTGGATG
CAGTTGTTGCCCAAGAGTCAGGATACAAGGCTTGGGCAATCAGCAGGGCCGGCGCAATGGGAATGATGCA
GGTTATGCCCGGAACCGCCAGGCATCTGGAGCTATGGAACCCTTGGGACGCCTTGGCGAACATGCGCGCG
GGCGCGCGATATCTTCGCCAGCAACTTGATCGTTTTGAACGCGTCGATCTCGCCCTGGCCGCCTACAATG
CCGGACCAGAGCGCCGCTCCCTCACGCTGGGCTATATCCCAGCGATCCCCGAAACCCGCAATTACGTGCG
AACCATCACAACCAACTGGCTCCGCCTTACCCAGCTCAATCGTCCAGATTCCAGCTCTCTTGCGCGAGCG
ACAGCAGCCAGCACAGCCGTCTGGGCATCAGGCTACCGCGAGGTTTCATTGGTCACCTACGACGGGACGA
ATTCCGCAAACCCGATATAG
 Primer design