SecReT4
Protein ID: 146280363
T4SS name [ID]VirB [191]
Gene symbol-
Locus tagRsph17025_4368
StrainRhodobacter sphaeroides ATCC 17025
Repliconplasmid pRSPA04 [GenBank: NC_009432] [Browse all T4SS(s) in this replicon]
Location [Strand]11754..13895 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDA4X0P9
KEGG IDrsq:Rsph17025_4368
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.3e-106, Aligned region: 154..579
TrwB_AAD_bind [PF10412], Evalue: 4.5e-27, Aligned region: 196..563
TraG-D_C [PF12696], Evalue: 9.8e-26, Aligned region: 428..549
Protein Sequence: 713 a.a.     [Download]
>gi|146280363|ref|YP_001170518.1| TRAG family protein [Rhodobacter sphaeroides ATCC 17025]
MIVANWHRLGRPAKAAALASAAAFCIGGGLAAQAWVLHWGLKVPLALPRDLLIWPQAALAGYSDPLTVKW
IKLAGLAGLLPTAALVAAILKARPKIDLHGTAAFARESEIAAAGMRAKAGLIAGFTGPLPSPHYGKPVGR
FGQLDEEHGRVKVEKKSRLNARNLLVYGGPEHMLLYAPTRSGKGVGVVVPNLLNWPDSAVVLDIKKENWQ
LTAGFRKAGGQEVFLFDPLDPEGRTHRWNPLASVRRGTAFQVEDLQRLADLFIPVASKDPFFDRAAQTAF
VGVGGYLAETPELPFTLGELYRQLTLTPNFVRTFKARIDERAEAGRPLSLQTIATLNDFLSKSENTFESV
KSTITANLGLFANPLLDRATAASDFDFADLRRKRMTIYVGITPNNLGRLGPLLNLFFQSCVDANMQELPE
HNPALKHRVLLCMDEFAAVGELPAFKRGIGYFAGYGLKVLTIVQTPAQLADIYGSDGAEAYMDNAGITVV
FTPKGLKEARNLSERLGTYGAEAISTSRSKLLASRNPPTISVSEQKRALMMPQELLQLDQSGAIILAAGH
PPIRAKKIRFYAEEAFLERSRIPPPEIPASRADATADDVRRLRDENRRMREDLSALTDEVRRIAALKLAQ
AANVAAGQPAEVPMTDEEIAKPETISFDRLALASDSVRAKIKSLAAAGTIGTKEGVAAILGEMGVAVPEE
KAAKPKKEKVRHG
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|146280352|ref|NC_009432.1|:c13895-11754 Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA04, complete sequence
ATGATCGTCGCGAACTGGCACCGGCTCGGTCGCCCGGCGAAGGCGGCGGCACTGGCCTCGGCCGCCGCCT
TCTGCATCGGCGGGGGCCTCGCGGCGCAGGCTTGGGTGCTGCACTGGGGGCTGAAGGTTCCCCTCGCCCT
GCCCCGTGATCTGCTGATCTGGCCGCAGGCGGCGCTCGCCGGCTATAGCGACCCGCTCACCGTGAAGTGG
ATCAAGCTAGCCGGGCTGGCGGGACTTCTGCCGACGGCCGCGCTGGTGGCGGCGATCCTGAAGGCGCGGC
CGAAGATCGACCTGCACGGCACGGCGGCCTTCGCGCGGGAAAGCGAGATCGCGGCGGCCGGCATGCGCGC
CAAGGCCGGGCTCATCGCAGGCTTCACCGGCCCCCTGCCCTCGCCGCACTACGGCAAGCCCGTGGGCCGG
TTTGGGCAGCTGGATGAAGAGCATGGCCGGGTGAAGGTGGAGAAGAAGAGCCGGCTGAACGCCCGGAACC
TGCTCGTCTACGGGGGGCCGGAGCACATGCTGCTCTATGCCCCCACCCGCTCCGGCAAGGGCGTCGGCGT
GGTCGTGCCGAACCTGCTGAACTGGCCGGACTCGGCCGTCGTCCTCGACATCAAGAAGGAGAACTGGCAG
CTGACGGCTGGCTTCCGCAAGGCCGGCGGGCAGGAGGTCTTCCTCTTCGACCCGCTGGACCCCGAGGGCC
GCACCCACCGCTGGAACCCGCTGGCGAGCGTCCGCCGCGGCACGGCCTTCCAGGTCGAGGACCTGCAGCG
CCTCGCTGACCTCTTCATCCCGGTGGCCTCCAAGGATCCGTTCTTCGACCGCGCCGCGCAGACCGCCTTC
GTCGGTGTCGGGGGCTATCTCGCCGAAACGCCGGAACTGCCTTTCACGCTGGGCGAGCTTTACCGACAGC
TGACGCTGACCCCGAACTTCGTGCGCACCTTCAAGGCCCGGATCGACGAGCGGGCCGAGGCCGGGCGGCC
GCTGTCGCTCCAGACGATCGCGACGCTGAACGACTTCCTCTCGAAAAGCGAAAACACCTTCGAGAGCGTG
AAATCGACCATCACCGCCAACCTCGGCCTCTTCGCCAACCCGCTCCTCGACCGTGCGACAGCGGCTTCGG
ACTTCGACTTCGCGGACCTCCGCCGGAAGCGGATGACGATCTATGTCGGGATCACTCCGAACAACCTCGG
CCGTCTCGGGCCGCTCCTGAACCTCTTCTTCCAGTCCTGCGTGGACGCCAACATGCAGGAGCTGCCCGAG
CACAATCCGGCGCTGAAGCACCGGGTCCTGCTCTGCATGGACGAGTTCGCGGCGGTGGGCGAGTTGCCTG
CCTTCAAGCGCGGCATCGGCTATTTCGCCGGCTACGGGCTGAAGGTGCTGACCATCGTCCAGACCCCGGC
GCAGCTTGCCGACATCTACGGGTCGGACGGCGCCGAAGCCTACATGGACAACGCCGGCATCACTGTGGTC
TTCACGCCGAAGGGGCTGAAGGAGGCGCGGAACCTCTCCGAACGGCTGGGGACCTACGGGGCCGAGGCCA
TCTCCACCTCGCGCTCGAAGCTGCTGGCCAGCCGCAACCCGCCCACGATCAGCGTGAGCGAGCAGAAGCG
GGCGCTGATGATGCCCCAGGAGCTGCTGCAGCTCGACCAGAGCGGGGCGATCATCCTCGCCGCCGGCCAC
CCGCCGATTCGGGCGAAGAAGATCCGCTTCTATGCCGAGGAAGCGTTCCTGGAGCGGAGCCGCATTCCCC
CGCCCGAGATCCCTGCCTCACGCGCTGACGCCACCGCCGACGATGTCCGGCGCCTGCGCGACGAGAACCG
GCGGATGCGCGAGGACCTGTCTGCCCTCACGGACGAGGTGCGCCGGATCGCGGCGCTGAAGCTCGCGCAG
GCGGCCAACGTGGCCGCGGGCCAGCCCGCCGAGGTGCCGATGACCGACGAGGAGATCGCGAAGCCCGAGA
CCATCTCCTTCGACCGGCTCGCGCTCGCCAGCGACAGCGTGCGGGCGAAGATCAAGAGCCTCGCCGCCGC
TGGCACGATCGGCACGAAGGAAGGCGTGGCCGCCATCCTGGGCGAGATGGGCGTGGCGGTGCCCGAAGAG
AAAGCCGCAAAGCCGAAGAAGGAGAAGGTGAGACATGGCTGA
 Primer design