SecReT4
Protein ID: 146280364
T4SS name [ID]VirB [191]
Gene symbol-
Locus tagRsph17025_4369
StrainRhodobacter sphaeroides ATCC 17025
Repliconplasmid pRSPA04 [GenBank: NC_009432] [Browse all T4SS(s) in this replicon]
Location [Strand]13892..14920 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDA4X0Q0
KEGG IDrsq:Rsph17025_4369
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.9e-81, Aligned region: 15..315
Mg_chelatase [PF01078], Evalue: 3.5e-05, Aligned region: 156..195
Protein Sequence: 342 a.a.     [Download]
>gi|146280364|ref|YP_001170519.1| type II secretion system protein E [Rhodobacter sphaeroides ATCC 17025]
MTSASPSLALTAFLAPIQPWLDRPDILEICVNRPGEVFVEDPRGWERIALPALSYEFLSGLVSTISSFAR
QKLNAEAPLLSASLPGGERVQVVLPPAVPAGTISLTIRKPAHRTFSLEALIGTGMFDAVETDPEALGAED
AQLIALHRDRRWPEFLAAAVAAKKNILISGATGSGKTTLSKALLPLIPETERLITIEDTLELELPQPNVV
RLIYSKGGQGDAKVTARDLLEASLRMRPDRIFLQELRDASAFYYLRNVNTGHSGSITTIHADSARLAFEQ
LALLVKESEAGRDLSRAEIKAMLVQMIDVVLQVKKAAHGRRVTEVWFDPRRKLEASGPEAAR
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|146280352|ref|NC_009432.1|:c14920-13892 Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA04, complete sequence
ATGACCAGCGCCTCCCCTTCGCTCGCCCTCACCGCTTTCCTCGCGCCGATCCAGCCCTGGCTCGATCGCC
CGGACATCCTGGAGATCTGCGTCAACCGCCCCGGCGAGGTCTTCGTCGAGGATCCGCGGGGCTGGGAGCG
GATCGCCCTGCCCGCCCTCAGCTACGAGTTCCTGTCGGGGCTGGTCTCCACCATCAGCAGCTTTGCCCGG
CAGAAGTTGAACGCCGAGGCGCCGCTGCTTTCGGCCTCGCTGCCGGGCGGCGAGCGGGTTCAGGTGGTGC
TGCCCCCGGCGGTGCCTGCGGGCACGATCAGCCTGACGATCCGGAAGCCCGCGCACCGCACCTTCTCGCT
GGAGGCGCTGATCGGCACGGGCATGTTCGACGCGGTCGAAACCGACCCGGAGGCACTAGGCGCCGAGGAT
GCGCAGCTAATCGCCTTGCACCGGGATCGGCGCTGGCCGGAGTTCCTCGCGGCCGCTGTGGCGGCGAAGA
AGAACATCCTGATTTCGGGCGCCACCGGCAGCGGCAAGACCACGCTGTCGAAGGCGCTGCTCCCGCTGAT
CCCCGAAACCGAGCGGCTCATCACCATCGAGGACACGCTGGAGCTGGAGCTGCCGCAGCCGAACGTGGTG
CGGCTCATCTATTCCAAGGGCGGCCAGGGCGACGCGAAGGTGACGGCCCGCGACCTGCTGGAGGCGTCAC
TCCGGATGCGGCCCGACCGGATCTTCCTGCAGGAGCTGCGCGACGCCTCGGCCTTCTACTACCTGCGGAA
CGTGAACACCGGCCATTCCGGCTCGATCACCACGATCCATGCGGACTCGGCTCGGCTCGCCTTCGAGCAG
CTGGCGCTGCTGGTCAAGGAGAGCGAGGCCGGCCGCGACCTCTCGCGCGCCGAGATCAAGGCGATGCTGG
TGCAGATGATCGACGTGGTCCTGCAGGTGAAGAAGGCCGCCCACGGCCGCCGCGTCACCGAGGTCTGGTT
CGATCCGCGCCGCAAGCTGGAGGCGTCCGGCCCGGAGGCCGCGCGATGA
 Primer design