SecReT4
Protein ID: 146280367
T4SS name [ID]VirB [191]
Gene symbol-
Locus tagRsph17025_4372
StrainRhodobacter sphaeroides ATCC 17025
Repliconplasmid pRSPA04 [GenBank: NC_009432] [Browse all T4SS(s) in this replicon]
Location [Strand]16912..17598 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA4X0Q3
KEGG IDrsq:Rsph17025_4372
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.3e-66, Aligned region: 15..225
Protein Sequence: 228 a.a.     [Download]
>gi|146280367|ref|YP_001170522.1| VirB8 family protein [Rhodobacter sphaeroides ATCC 17025]
MIARDDKELAAYLKAARTFDYDQRLAAERSKRVAWALAGVASLLATASVVAVAALAPLKEVVPFVIRVDQ
ATGVPEVMTALTDGRESYDEAVARYFLARYARVRESYSFAERQNIFHEVTLMSAPEVTRQFSEFFNATNP
KSPQYLYGRDTHASIRIRSISFLGDQLAQVRFTRTERNEREKLKKETLWVSTIQFEFDPKAEISAEDRLV
NPLGFIVRNYRVDPEVVQ
 
Nucleotide Sequence: 687 bp     [Download]
>gi|146280352|ref|NC_009432.1|:c17598-16912 Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA04, complete sequence
ATGATCGCCAGGGACGACAAGGAATTGGCGGCCTACCTGAAGGCCGCGCGGACCTTCGACTATGACCAGA
GGCTCGCGGCGGAACGCTCGAAGCGCGTCGCCTGGGCGCTCGCGGGCGTGGCAAGCCTTCTGGCCACCGC
AAGCGTGGTGGCGGTGGCAGCCCTCGCGCCGCTGAAGGAGGTGGTGCCCTTCGTGATCCGCGTCGATCAG
GCGACCGGCGTGCCCGAGGTCATGACCGCGCTGACGGACGGCCGGGAGAGCTACGACGAGGCGGTGGCGC
GCTATTTCCTCGCCCGCTACGCCCGCGTGCGCGAGAGCTACAGCTTTGCCGAGCGCCAGAACATCTTCCA
CGAGGTGACGCTCATGTCGGCGCCCGAGGTGACGCGGCAGTTCTCCGAGTTCTTCAACGCCACCAACCCC
AAGAGCCCGCAGTACCTCTATGGCCGCGACACCCACGCCAGCATCCGCATCCGGTCGATCTCGTTCCTTG
GCGACCAGCTTGCACAGGTCCGCTTCACCCGGACCGAGCGCAACGAGCGTGAAAAGCTGAAGAAGGAAAC
CCTCTGGGTCTCGACGATCCAGTTCGAGTTCGACCCCAAGGCCGAGATCAGCGCCGAGGACCGGCTGGTC
AACCCGCTCGGCTTCATCGTCCGCAACTACCGCGTCGATCCGGAGGTGGTCCAATGA
 Primer design