SecReT4
Protein ID: 146284610
T4SS name [ID]Tra_F [122]
Gene symbol-
Locus tagEnt638_4284
StrainEnterobacter sp. 638
Repliconplasmid pENTE01 [GenBank: NC_009425] [Browse all T4SS(s) in this replicon]
Location [Strand]109209..109514 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDA4WGS1
KEGG IDent:Ent638_4284
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 8.6e-33, Aligned region: 7..100
Protein Sequence: 101 a.a.     [Download]
>gi|146284610|ref|YP_001165563.1| conjugal transfer pilus assembly protein TraL [Enterobacter sp. 638]
MMSGEEDKYYFPETLNQQERYFGLPLDEIIIVAPLIILGVLNNMSTELSIIAGLLWASVRYLKKGQGSFW
LLNFCYWHLPSLLFKVTFRKIPDSSFRHWRA
 
Nucleotide Sequence: 306 bp     [Download]
>gi|146284526|ref|NC_009425.1|:109209-109514 Enterobacter sp. 638 plasmid pENTE01, complete sequence
ATGATGAGCGGGGAAGAGGATAAATACTACTTCCCGGAAACGCTCAATCAGCAGGAACGCTATTTCGGTT
TGCCCTTAGACGAAATCATTATTGTTGCGCCTCTGATTATCCTGGGCGTGCTCAATAATATGTCTACCGA
ACTTTCCATAATAGCGGGCCTGCTCTGGGCATCAGTCAGGTATCTGAAAAAAGGACAAGGCTCTTTCTGG
TTACTGAATTTCTGTTACTGGCATCTGCCTTCTCTTTTATTCAAGGTCACCTTCCGAAAAATACCTGATT
CCAGCTTCCGGCACTGGAGGGCGTAA
 Primer design