SecReT4
Protein ID: 146284625
T4SS name [ID]Tra_F [122]
Gene symbol-
Locus tagEnt638_4299
StrainEnterobacter sp. 638
Repliconplasmid pENTE01 [GenBank: NC_009425] [Browse all T4SS(s) in this replicon]
Location [Strand]122728..123513 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDA4WGT6
KEGG IDent:Ent638_4299
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.6e-77, Aligned region: 31..251
Protein Sequence: 261 a.a.     [Download]
>gi|146284625|ref|YP_001165578.1| conjugal pilus assembly protein TraF [Enterobacter sp. 638]
MKRLMCGLLMVVTSLPAIAEEIITPADPFTGWSWYNEPKTPPDKYPKPQQPAPPTTIPDLSKMTALEQAK
VLKGYTMEALNRAILYPTRENTATFLRWQKFWTDRGSMFSQSFAAAQLSHPDLDYNLEYPHYNSMAPFVQ
TRDQQTQQNAVAQLSQQYGLFYFYRGSDPIDVQMAGVVADFAKTNGISLIPVSVDGQVAATLPQSRPDTG
QSHTMNISHYPALFLVDAKSKNYRALSYGFMTQDDLSKRFLNVATGFKPHS
 
Nucleotide Sequence: 786 bp     [Download]
>gi|146284526|ref|NC_009425.1|:122728-123513 Enterobacter sp. 638 plasmid pENTE01, complete sequence
ATGAAAAGACTGATGTGCGGCCTGCTGATGGTCGTGACCAGTCTGCCAGCCATTGCGGAGGAGATTATCA
CCCCCGCCGACCCGTTCACCGGCTGGTCCTGGTATAACGAACCGAAAACGCCCCCGGATAAGTACCCGAA
ACCTCAGCAACCCGCGCCGCCGACGACCATTCCTGATCTCAGTAAAATGACCGCGCTGGAGCAGGCAAAG
GTGCTGAAGGGCTACACGATGGAGGCGCTAAACCGCGCCATCCTGTACCCCACGCGGGAGAACACGGCGA
CGTTCCTGCGCTGGCAGAAGTTCTGGACTGACCGGGGCTCCATGTTCAGCCAGTCATTCGCAGCGGCCCA
GCTGAGTCATCCTGATCTGGATTACAACCTGGAGTACCCGCACTACAACAGCATGGCCCCGTTTGTGCAG
ACGCGCGATCAGCAGACGCAGCAAAACGCGGTCGCGCAGCTGTCTCAGCAATATGGTCTGTTCTACTTCT
ACCGGGGCAGTGACCCGATTGATGTGCAGATGGCCGGGGTGGTGGCTGATTTTGCGAAAACGAACGGGAT
ATCCCTCATCCCCGTGTCGGTCGACGGGCAGGTGGCAGCAACATTACCGCAGAGCCGTCCGGATACGGGC
CAGTCGCATACGATGAACATCTCGCACTACCCGGCCCTGTTCCTGGTTGATGCAAAAAGCAAAAACTACC
GCGCCCTGTCTTACGGCTTTATGACGCAGGACGACCTGTCGAAGCGCTTCCTGAACGTGGCCACCGGCTT
TAAACCCCACTCCTGA
 Primer design