SecReT4
Protein ID: 146284638
T4SS name [ID]Tra_F [122]
Gene symbol-
Locus tagEnt638_4312
StrainEnterobacter sp. 638
Repliconplasmid pENTE01 [GenBank: NC_009425] [Browse all T4SS(s) in this replicon]
Location [Strand]144003..144770 [-]
ProductTraX family protein
Component typeTraX_F
UniProt IDA4WGU9
KEGG IDent:Ent638_4312
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 1.1e-50, Aligned region: 23..252
Protein Sequence: 255 a.a.     [Download]
>gi|146284638|ref|YP_001165591.1| TraX family protein [Enterobacter sp. 638]
MNHSVPGLLHSLQTPGRVSPAALDMVKVLALLAMLGDHINTLFLTPPEPLAYAAGRMAFPLFTLIWAMNV
QRRPERLQVRANRQWIWAVITQPVFSLAFAGHQPWWALNILFVFAGVTQLLALQYRYGKKGLMAGALVLG
ILVWPLSPASYGLAGIALATGMVTATGGKTPGVQRAGIIVTVLSLCSLNGVSHLLSLPADTLLFATLPTL
VFPLMAVSLSIQWCPAGDQRFMPRHFFYIAYTGHLLVLLILMQLW
 
Nucleotide Sequence: 768 bp     [Download]
>gi|146284526|ref|NC_009425.1|:c144770-144003 Enterobacter sp. 638 plasmid pENTE01, complete sequence
GTGAATCATTCAGTTCCTGGCCTTCTTCACAGTCTTCAGACTCCCGGCAGGGTCAGTCCTGCCGCCCTGG
ATATGGTCAAGGTACTGGCGCTGCTCGCCATGCTGGGCGACCACATCAACACGCTGTTCCTGACGCCCCC
CGAACCGCTGGCGTATGCGGCTGGCCGGATGGCCTTCCCCCTGTTCACGCTTATCTGGGCGATGAACGTG
CAGCGCAGACCAGAACGGCTCCAGGTGAGGGCGAACCGTCAGTGGATATGGGCCGTCATCACCCAGCCGG
TGTTCAGTCTGGCCTTTGCCGGGCATCAGCCCTGGTGGGCACTGAATATCCTGTTCGTGTTCGCAGGCGT
CACGCAGCTGCTTGCCCTGCAGTACCGGTACGGGAAGAAAGGACTGATGGCCGGCGCTCTGGTGCTGGGC
ATCCTTGTCTGGCCGCTGAGTCCGGCCAGTTACGGTCTGGCGGGTATTGCCCTGGCCACCGGCATGGTGA
CAGCGACAGGCGGAAAAACGCCCGGCGTGCAGCGTGCGGGAATTATCGTGACCGTGCTGTCGCTGTGCAG
CCTGAACGGGGTATCGCATCTGCTGAGTCTGCCGGCAGACACGCTGTTATTCGCCACCCTTCCGACACTG
GTGTTCCCCCTGATGGCCGTATCCCTGAGCATCCAGTGGTGTCCTGCAGGCGATCAGCGCTTTATGCCCC
GACATTTTTTCTACATTGCTTATACCGGCCACCTGCTGGTACTGCTCATCCTGATGCAGCTCTGGTGA
 Primer design