SecReT4
Protein ID: 146318580
T4SS name [ID]Tra_Tn [655]
Gene symbol-
Locus tagSSU05_0926
StrainStreptococcus suis 05ZYH33
Repliconchromosome [GenBank: NC_009442] [Browse all T4SS(s) in this replicon]
Location [Strand]898643..901099 [-]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDA4VUV3
KEGG IDssu:SSU05_0926
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.4e-33, Aligned region: 471..766
Protein Sequence: 818 a.a.     [Download]
>gi|146318580|ref|YP_001198292.1| hypothetical protein SSU05_0926 [Streptococcus suis 05ZYH33]
MNFMAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTES
SIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNA
LSDFVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEY
EYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQ
QQFTFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKES
MYKLSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFL
AGLGFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYY
AVLYGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLT
GISSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQ
SISLEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQ
VAQGKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDEN
NQKRLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 2457 bp     [Download]
>gi|146317663|ref|NC_009442.1|:c901099-898643 Streptococcus suis 05ZYH33 chromosome, complete genome
GTGAATTTTATGGCATATCCAATTAAATACATTGAAAACAATCTCGTCTGGAATAAAGACGGGGAATGTT
ATGCTTACTATGAGCTTGTTCCTTACAATTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGA
TTCTTTCAGACAGCTTATCGCACAAAATCGTGATGGCAAAATTCATGCTTTACAAATCAGTACAGAATCC
AGCATACGTTCTGCACAAGAGCGTTCCAAAAATGAAGTCACTGGCAAGCTCAAAGCGGTTGCCTATGACA
AAATCGACCAACAGACAGACGCTTTAATATCCATGATTGGCGAAAATCAAGTGAACTACCGTTTCTTTAT
CGGCTTTAAGTTGCTTCTCAACGATCAGGAGTTTTCTATGAAAAGTCTTACCGTTGAAGCAAAAAATGCT
TTGTCTGATTTTGTCTATGATGTGAACCATAAGCTGATGGGCGATTTTGTTAGTATGAGTAATGATGAAA
TCCTGCGTTTTCAGAAGATGGAAAAGCTCTTAGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGGTT
AGATAAGGACGACTTCGGCTATCTGATTGAACACCTTTACGGACAGACAGGCACTGCCTATGAAGAGTAT
GAGTACCATCTATCAAAGAAAAAGCTGGATAATGAAACGCTGATTAAATACTATGACTTGATTAAGCCTA
CTCGCTGTTTGGTGGAAGAAAAACAGCGATATTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTAGC
TTACTTTACCATTAACAGCATTGTCGGAGAACTGGACTTCCCGTCCTCTGAAATCTTCTACTACCAGCAA
CAGCAATTTACATTCCCGATTGATACGTCAATGAATGTGGAAATTGTAGCGAATCGTAAAGCCCTATCTA
CTGTCCGCAATAAAAAGAAAGAACTGAAAGACTTGGATAACCACGCTTGGCAAAGTGATAATGAAACCAG
CTCCAATGTGGCGGAAGCTCTGGAAAGTGTGAATGAGCTGGAAACCAATTTAGACCAAAGCAAGGAATCT
ATGTACAAGCTGTCTTATGTGGTAAGGGTATCAGCAAATGATCTTGACGAACTCAAACGTCGTTGTAATG
AAGTGAAAGATTTTTATGACGATTTAAGCGTAAAACTGGTACGACCATTTGGGGATATGCTCGGCTTACA
TGAAGAATTTTTACCTGCCAGCAAGCGTTATATGAATGATTATATTCAATACGTGACCTCTGATTTCCTC
GCTGGTTTAGGTTTTGGTGCTACTCAAATGCTGGGGGAAAATGAGGGGATTTATGTTGGCTACAGCTTAG
ATACTGGACGCAATGTCTATCTGAAACCTGCTCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGC
GTTAGCGTCGGCTTTTGTTGGTTCGCTGGGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTAT
GCGGTGCTTTATGGGGCACAAGCAGTGATTGTAGACCCAAAAGCAGAACGTGGCAGATGGAAAGAAACCT
TGCCAGAGATTTCCCATGAAATCAATATCGTCACTCTGACTTCTGATGAGAAAAACAAAGGCTTACTTGA
CCCTTATGTGATTATGAAAAATCCCAAAGATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACG
GGGATTTCCTCTCGTGATGGGGAACGCTTCCCAATCCTTAGAAAAGCCATTCGTGCAGTAACCAATAGTG
AAGTACGAGGGTTGATGAAAGTGATTGAGGAATTACGGGTTGAGAATACGCCACTAAGTACCAGTATAGC
CGACCATATCGAAAGTTTTACAGACTATGACTTTGCACATTTATTATTCAGTAATGGTTATGTGGAGCAG
TCTATCAGCTTAGAAAAACAACTGAACATTATACAGGTTGCGGACTTGGTACTTCCCGACAAGGAAACTT
CCTTTGAGGAATATACCACTATGGAGCTTTTATCCGTTGCTATGCTGATTGTCATTAGTACCTTTGCTTT
AGACTTTATCCATACAGACCGAAGCATTTTCAAGATTGTAGATTTAGACGAAGCATGGAGCTTTTTACAG
GTAGCACAAGGAAAAACACTATCTATGAAGCTGGTTCGGGCTGGTCGTGCTATGAACGCTGGGGTATATT
TCGTGACCCAAAATACAGACGACCTCTTAGATGAAAAACTGAAAAATAACCTCGGCTTAAAATTTGCATT
TCGTTCCACTGACCTTAACGAGATTAAAAAGACCTTAGCCTTTTTTGGTGTAGACCCAGAGGACGAAAAC
AATCAGAAGCGATTGCGTGATTTGGAAAACGGGCAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTG
TGATACAGTTCCACCCTGTATTTGAAGAACTGCTCCATGCCTTTGATACCAGACCACCTGTGCGAAAAGA
GGTGTAA
 Primer design