SecReT4
Protein ID: 146320776
T4SS name [ID]Tra_Tn [656]
Gene symbol-
Locus tagSSU98_0929
StrainStreptococcus suis 98HAH33
Repliconchromosome [GenBank: NC_009443] [Browse all T4SS(s) in this replicon]
Location [Strand]894243..895175 [-]
ProductTn916 hypothetical protein
Component typeOrf13_Tn
UniProt IDA4W148
KEGG IDssv:SSU98_0929
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1.3e-62, Aligned region: 83..310
Protein Sequence: 310 a.a.     [Download]
>gi|146320776|ref|YP_001200487.1| Tn916 hypothetical protein [Streptococcus suis 98HAH33]
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETTI
IEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQI
WTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIES
EGTVDSITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTV
EYIDQQTKATQVSQFDLVLEKNGSNWKIVK
 
Nucleotide Sequence: 933 bp     [Download]
>gi|146319850|ref|NC_009443.1|:c895175-894243 Streptococcus suis 98HAH33, complete genome
ATGAGAAAGGAAGATTTAATGATGAAATTTAGAAAAAATCAGAATAAAGAAAAACAGATACCAAAGGAAA
AGAAACCTCGTGTCTATAAGGTCAATCCTCATAAAAAGGTTGTGATTGCCTTGTGGGTACTTTTAGGGCT
TAGTTTCAGCTTTGCGATATTCAAGCACTTTACAGCTATAGATACTCATACTATTCACGAAACAACTATC
ATAGAAAAGGAATACGTTGATACTCATCATGTAGAAAATTTTGTAGAGAACTTTGCGAAAGTCTACTATT
CATGGGAGCAATCCGATAAGTCCATTGATAATCGAATGGAAAGTCTAAAAGGCTATCTGACAGATGAACT
TCAAGCTCTCAATGTTGATACAGTACGCAAAGATATTCCTGTATCGTCTTCTGTAAGAGGATTTCAGATA
TGGACGGTAGAGCCAACTGGCGACAATGAGTTTAATGTAACCTACAGTGTAGACCAGCTCATTACAGAGG
GAGAAAATACAAAGACCGTCCACTCTGCTTATATAGTGAGTGTCTATGTAGATGGTTCTGGAAATATGGT
ACTGGTTAAGAATCCGACCATTACCAACATACCTAAGAAATCAAGTTATAAACCAAAAGCCATTGAAAGT
GAGGGGACGGTTGATTCCATTACAACCAATGAAATCAATGAGTTTTTAACGACGTTCTTCAAGCTCTATC
CTACAGCGACAGCCAGTGAACTTTCCTACTATGTGAATGACGGGATATTAAAACCAATCGGAAAAGAGTA
CATCTTTCAAGAACTGGTAAATCCTATTCACAATCGTAAGGATAATCAAGTCACGGTATCGCTGACAGTG
GAGTATATCGACCAGCAGACCAAAGCAACGCAGGTATCTCAATTTGATTTGGTACTTGAAAAGAACGGGA
GTAATTGGAAGATTGTAAAATAA
 Primer design