SecReT4
Protein ID: 146320777
T4SS name [ID]Tra_Tn [656]
Gene symbol-
Locus tagSSU98_0930
StrainStreptococcus suis 98HAH33
Repliconchromosome [GenBank: NC_009443] [Browse all T4SS(s) in this replicon]
Location [Strand]895172..896173 [-]
Producthypothetical protein
Component typeOrf14_Tn
UniProt IDA4W149
KEGG IDssv:SSU98_0930
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 8.1e-61, Aligned region: 46..202
NLPC_P60 [PF00877], Evalue: 1.2e-31, Aligned region: 224..329
Protein Sequence: 333 a.a.     [Download]
>gi|146320777|ref|YP_001200488.1| hypothetical protein SSU98_0930 [Streptococcus suis 98HAH33]
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKYAKEYGVEEYV
NILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLASSERLSVDLESVIQSYNYGG
GFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDD
TVQAIMDEALKYEGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLV
FFHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|146319850|ref|NC_009443.1|:c896173-895172 Streptococcus suis 98HAH33, complete genome
ATGAAGTTGAAAACTTTAGTGATTGGTGGTTCTGGGCTATTCTTGATGGTCTTCTCACTGCTTCTGTTTG
TTGCCATTTTATTTTCAGATGAACAGGACAGCGGAATTTCCAATATTCATTATGGAGGTGTGAATGTTTC
CGCAGAAGTGCTGGCTCATAAGCCTATGGTAGAAAAATATGCCAAAGAATATGGCGTTGAAGAATATGTC
AACATACTTCTTGCGATTATACAGGTGGAATCGGGCGGTACTGCGGAAGATGTTATGCAGTCCTCGGAAT
CCCTCGGTCTTCCACCTAATTCATTGAGTACAGAAGAATCCATTAAGCAAGGTGTGAAGTATTTCAGTGA
ATTATTAGCCAGTAGCGAAAGGCTCAGTGTAGATTTAGAATCGGTTATCCAGTCCTACAATTATGGTGGT
GGTTTCTTAGGGTATGTGGCTAATCGTGGAAATAAATATACCTTTGAACTGGCTCAAAGTTTCTCAAAAG
AGTATTCAGGTGGCGAAAAAGTGTCTTACCCCAATCCCATAGCCATACCTATCAATGGGGGCTGGCGATA
CAACTATGGCAATATGTTTTATGTGCAACTGGTAACGCAGTATCTTGTCACAACAGAGTTTGATGATGAT
ACGGTACAAGCCATCATGGACGAAGCACTGAAATATGAGGGCTGGCGATACGTTTACGGTGGAGCTTCCC
CGACTACTTCTTTTGATTGTAGCGGACTGACACAATGGACGTATGGAAAAGCTGGAATTAACTTACCACG
AACCGCACAACAGCAATATGATGTGACCCAGCATATCCCACTATCGGAAGCACAAGCTGGCGATTTGGTT
TTCTTTCATTCTACCTATAACGCTGGCTCTTATATTACTCATGTTGGGATATACCTTGGCAATAACCGTA
TGTTTCATGCAGGCGACCCAATCGGTTATGCCGACTTAACAAGCCCCTACTGGCAACAGCATTTAGTGGG
AGCAGGACGAATCAAACAATGA
 Primer design