SecReT4
Protein ID: 146320778
T4SS name [ID]Tra_Tn [656]
Gene symbol-
Locus tagSSU98_0931
StrainStreptococcus suis 98HAH33
Repliconchromosome [GenBank: NC_009443] [Browse all T4SS(s) in this replicon]
Location [Strand]896170..898347 [-]
Producthypothetical protein
Component typeOrf15_Tn
UniProt IDA4W150
KEGG IDssv:SSU98_0931
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 725 a.a.     [Download]
>gi|146320778|ref|YP_001200489.1| hypothetical protein SSU98_0931 [Streptococcus suis 98HAH33]
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYSRYPLENYQLD
FYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQEAYSLDFISATADSIGKNMQT
LAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKK
INDFSSDISNASLSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLL
STSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFII
YAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQS
GSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKV
KENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEMEQVKQKKQPASSVHERPTTRQEQYHDEQTS
KQSNIQTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQ
RVPLQNTRSRPPIKTATIKKVGKKP
 
Nucleotide Sequence: 2178 bp     [Download]
>gi|146319850|ref|NC_009443.1|:c898347-896170 Streptococcus suis 98HAH33, complete genome
GTGAAACCATCAATAGTAAACAGAATAAAATCAAACTGGACGCTGAAACGTCTAGGTAAAGTGGCAATGA
CAGTGGCTTTCACACTTGTGATTGCCATTTTTCTTTTAGCCATGCTGGGAACGGTGGTTCAAGCTGCGGG
CTTGGTAGATGATACGGTCAATGTGGCAAATGAATACAGCCGATACCCACTTGAAAACTATCAACTGGAT
TTTTATGTGGATAATAGCTGGGGCTGGCTTCCGTGGAACTGGTCGGACGGGATTGGAAAACAGGTCATGT
ATGGACTATATGCCATTACCAATTTTATTTGGACAATCAGTTTGTATGTTTCCAATGCGACAGGTTACTT
AGTACAGGAAGCCTATTCCTTAGACTTCATTTCCGCTACAGCAGATTCCATTGGTAAGAATATGCAGACC
TTAGCTGGTGTGAGTGCAAACGGATTTTCAACAGAGGGTTTCTATGTTGGATTCCTCTTACTCTTGATTT
TGGTTCTTGGGGTTTATGTTGCCTATACGGGACTGATAAAGAGAGAAACCACAAAGGCAATTCATGCCAT
TATGAATTTTGTGCTGGTGTTTATCCTATCGGCTTCCTTTATTGCCTACGCTCCCGACTACATTAAAAAA
ATCAATGACTTTTCATCAGACATCAGTAATGCCAGTTTATCACTTGGCACGAAGATTGTCATGCCCCATT
CCGATAGTCAAGGCAAGGACAGCGTGGACTTAATCAGAGATAGCCTGTTTTCCATACAGGTTCAGCAACC
GTGGCTACTGCTTCAATACAACAGTTCAGACATTGAAAGTATCGGTATTGACCGTGTGGAAAGCCTGCTC
TCCACCAGCCCAGATTCCAACAATGGCGAAGACAGAGAAAAAATTGTTGCGGAAGAAATTGAAGACAGAA
GCAATACCAATCTAACCATTACAAAGACCATTAACCGTTTAGGTACAGTCTTCTTCCTATTTGTCTTCAA
TATTGGGATTTCCATATTTGTATTCCTATTAACAGGAATCATGATTTTCTCGCAGGTACTTTTTATCATC
TATGCTATGTTTCTGCCTGTGAGCTTTATTTTAAGCATGATTCCATCATTTGATGGTATGTCAAAACGAG
CCATAACAAAGCTCTTTAATACCATTTTGACACGAGCTGGAATCACATTGATTATTACGACAGCATTTAG
TATTTCAACCATGCTCTATACCTTATCGGCTGGTTATCCGTTCTTTTTGATTGCTTTTCTACAGATTGTG
ACCTTTGCAGGAATCTACTTCAAGCTGGGCGATTTAATGAGTATGTTTTCTCTACAGAGTAACGATTCTC
AAAGTGTGGGAAGTCGTGTGATGAGAAAACCTCGTATGCTTATGCACGCTCACATGCACCGTCTACAGCG
GAAACTTGGACGTTCCATGACTACTCTAGGGGCTGGGTCTGCCATTGTTACAGGTAAAAAAGGACAGTCG
GGTTCGGGGAGTTCTGCAAGGACACAAGCAGATCACTCCCGACCAGACGGAAAGGAAAAATCAACACTTG
GAAAACGTATCGGTCAAACCATCGGTACAGTAGCTGATACCAAAGACAGAATGGTAGACACTGCTAGTGG
TTTGAAAGAACAGGTTAAAGATTTGCCGACCAATGCAAGATATGCAGTATATCAAGGAAAATCCAAAGTA
AAAGAGAATGTCCGTGATTTAACCAGTAGTATTTCTCAAACCAAAGCGGACAGAGCCAGTGGACGCAAGG
AACAGCAGGAACAAAGGCGAAAAACCATTGCGAAGCGTCGCTCTGAAATGGAACAGGTCAAACAGAAAAA
ACAGCCTGCTTCTTCTGTTCATGAAAGACCGACTACAAGACAAGAACAATATCATGATGAACAGACCTCA
AAACAGTCTAATATTCAGACTTCATATAAGGAATCTCAACAAGCCAAACAAGAGCGTCCAGCAGTTAAGT
CCGATTTTTCAAGTCCAAAAGTGGAACGCCAAGGCAATACCGTTCAAGAAAAAACCGTTCAAAAGCCAGC
AACTTCAACCACTACAGCAGATAGAACTTCACAACGTCCAATCACAAAAGAACGTCCGTCTACTGTTCAA
AGAGTACCACTACAAAATACAAGAAGTAGACCACCAATCAAAACCGCCACCATTAAGAAAGTCGGTAAGA
AACCATGA
 Primer design