SecReT4
Protein ID: 146320780
T4SS name [ID]Tra_Tn [656]
Gene symbol-
Locus tagSSU98_0933
StrainStreptococcus suis 98HAH33
Repliconchromosome [GenBank: NC_009443] [Browse all T4SS(s) in this replicon]
Location [Strand]900781..901218 [-]
Producthypothetical protein
Component typeOrf17_Tn
UniProt IDA4W152
KEGG IDssv:SSU98_0933
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 1.9e-34, Aligned region: 21..122
Protein Sequence: 145 a.a.     [Download]
>gi|146320780|ref|YP_001200491.1| hypothetical protein SSU98_0933 [Streptococcus suis 98HAH33]
MAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSINDFRLPFPITFTQMTWFVVSLFAVMILGNLPPLSM
IEGAFLKYFGIPVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTYAGKKVTLGRNQPQEAITAVRSEF
YGISN
 
Nucleotide Sequence: 438 bp     [Download]
>gi|146319850|ref|NC_009443.1|:c901218-900781 Streptococcus suis 98HAH33, complete genome
GTGGCTCAATCAGCTACCCCTATTTTTTATGAAAGGATTGATTACATGAAGAAAATACGAAGCTATACCA
GTATCTGGTCTGTGGAAAAGGTACTGTATTCTATCAATGATTTTAGACTTCCGTTTCCCATAACCTTTAC
GCAAATGACATGGTTTGTCGTGTCACTCTTTGCAGTGATGATACTTGGCAACTTGCCCCCTCTTTCCATG
ATAGAGGGAGCATTTCTCAAATACTTTGGGATTCCTGTGGCTTTCACATGGTTTATGTCTACAAAAACTT
TTGATGGTAAAAAGCCTTATGGATTTTTGAAGTCTGTCATTGCTTATGCACTGCGACCAAAGCTGACCTA
TGCAGGAAAAAAAGTAACGCTTGGCAGAAACCAGCCACAAGAAGCCATTACAGCAGTTAGGAGTGAATTT
TATGGCATATCCAATTAA
 Primer design