SecReT4
Protein ID: 146320782
T4SS name [ID]Tra_Tn [656]
Gene symbol-
Locus tagSSU98_0935
StrainStreptococcus suis 98HAH33
Repliconchromosome [GenBank: NC_009443] [Browse all T4SS(s) in this replicon]
Location [Strand]901786..902097 [-]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDA4W154
KEGG IDssv:SSU98_0935
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 103 a.a.     [Download]
>gi|146320782|ref|YP_001200493.1| hypothetical protein SSU98_0935 [Streptococcus suis 98HAH33]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVKDILSRAIQSH
YWCLNKTVLLWNISGFLMFRKGMVHQTKCGRDF
 
Nucleotide Sequence: 312 bp     [Download]
>gi|146319850|ref|NC_009443.1|:c902097-901786 Streptococcus suis 98HAH33, complete genome
ATGAATTTTGGACAAAACCTTTATAACTGGTTTCTATCAAACGCTCAATCACTGGTGCTTTTAGCAATCG
TTGTGATTGGCTTGTATCTTGGCTTCAAGCGTGAGTTTAGCAAACTGATTGGCTTTTTAATTATTGCGAT
TATTGCGGTTGGCTTAGTCTTCAACGCTGCTGGAGTAAAAGACATTTTATCTAGAGCTATTCAATCGCAT
TATTGGTGCTTAAATAAAACCGTTCTTTTGTGGAATATAAGTGGTTTTCTTATGTTCCGCAAAGGAATGG
TACACCAAACGAAGTGCGGTAGGGATTTTTGA
 Primer design