SecReT4
Protein ID: 146320784
T4SS name [ID]Tra_Tn [656]
Gene symbol-
Locus tagSSU98_0937
StrainStreptococcus suis 98HAH33
Repliconchromosome [GenBank: NC_009443] [Browse all T4SS(s) in this replicon]
Location [Strand]903523..904908 [-]
Producthypothetical protein
Component typeOrf21_Tn
UniProt IDA4W156
KEGG IDssv:SSU98_0937
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.5e-41, Aligned region: 187..365
AAA_10 [PF12846], Evalue: 4.4e-06, Aligned region: 222..259
DUF87 [PF01935], Evalue: 2.3e-05, Aligned region: 222..340
Protein Sequence: 461 a.a.     [Download]
>gi|146320784|ref|YP_001200495.1| hypothetical protein SSU98_0937 [Streptococcus suis 98HAH33]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|146319850|ref|NC_009443.1|:c904908-903523 Streptococcus suis 98HAH33, complete genome
ATGAAACAGCGTGGTAAAAGGATTCGCCCATCTGGTAAAGATTTAGTCTTTCATTTTACGATAGCGTCAC
TCCTGCCTGTTTTCCTGCTGGTTGTCGGACTGTTTCATGTGAAGACAATCCAGCAGATCAACTGGCAGGA
TTTTAACCTATCACAAGCAGATAAGATTGACATTCCCTATTTAATTATCAGTTTCAGTGTCGCAATTCTT
ATCTGCTTGCTGGTAGCGTTTGTATTCAAACGGGTTCGCTATGATACGGTTAAACAACTTTACCACCGTC
AAAAACTGGCAAAGATGATACTTGAAAACAAGTGGTATGAATCTGAACAGGTCAAAACAGAGGGTTTCTT
TAAAGATAGTGCTGGTCGTACAAAGGAAAAGATAACCTACTTCCCTAAAATGTATTATCGACTTAAAAAT
GGCTTGATACAGATACGGGTGGAAATCACGCTGGGAAAATATCAAGACCAACTCTTACACTTGGAAAAGA
AATTAGAGAGTGGCTTGTACTGTGAGCTGACGGATAAAGAGTTAAAGGATTCCTATGTGGAATATACTTT
GCTCTATGACACCATAGCCAGTCGTATTTCTATTGATGAAGTAGAAGCTAAAGATGGTAAACTTCGCTTA
ATGAAAAACGTATGGTGGGAATATGATAAGCTCCCTCATATGTTGATTGCTGGTGGTACAGGTGGCGGTA
AAACTTACTTTATACTGACACTGATTGAAGCCTTGCTTCATACAGATTCAAAACTGTATATTCTTGACCC
GAAAAATGCTGATCTTGCGGACTTAGGTTCTGTGATGGCAAATGTCTACTATAGAAAAGAAGACTTGCTT
TCTTGCATTGAAACATTCTATGAAGAAATGATGAAACGTAGTGAGGAAATGAAGCAGATGAAGAACTATA
AGACTGGCAAAAATTATGCTTACTTAGGTCTCCCGGCACACTTCTTAATCTTTGATGAATACGTCGCTTT
CATGGAAATGCTGGGAACAAAAGAAAACACCGCAGTTATGAATAAGCTGAAACAGATTGTCATGTTAGGT
CGTCAAGCTGGCTTCTTTCTAATACTGGCTTGTCAACGTCCAGACGCAAAATATTTAGGCGACGGAATCC
GTGATCAGTTTAATTTCAGAGTGGCTTTAGGTCGTATGTCTGAAATGGGCTATGGCATGATGTTTGGCAG
TGACGTACAAAAGGATTTCTTCTTAAAGCGAATCAAAGGTCGTGGCTATGTTGATGTAGGAACAAGTGTC
ATATCAGAGTTTTATACTCCCCTTGTACCAAAAGGATATGATTTCTTGGAGGAAATTAAAAAGTTATCCA
ACAGCAGACAGTCCACGCAGGCGACGTGCGAAGCGGAAGTCGCAGGTGTGGACTGA
 Primer design