SecReT4
Protein ID: 148241055
T4SS name [ID]VirB [192]
Gene symbol-
Locus tagBBta_p0247
StrainBradyrhizobium sp. BTAi1
Repliconplasmid pBBta01 [GenBank: NC_009475] [Browse all T4SS(s) in this replicon]
Location [Strand]179075..181021 [-]
Productputative type IV secretory pathway protein VirD4
Component typeVirD4
UniProt IDA5EUP0
KEGG IDbbt:BBta_p0247
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.6e-109, Aligned region: 100..542
TraG-D_C [PF12696], Evalue: 1.7e-27, Aligned region: 391..512
TrwB_AAD_bind [PF10412], Evalue: 2.8e-25, Aligned region: 215..519
Protein Sequence: 648 a.a.     [Download]
>gi|148241055|ref|YP_001220556.1| putative type IV secretory pathway protein VirD4 [Bradyrhizobium sp. BTAi1]
MTPLANATTSVRTAQGLAVALAACAVFLLVASNVLLLGLRLHDGGLHWSEIATGWSRYGADPRFDRWLTL
STLVGVVVVFGLLGAIFRHRPSPLHGSARFASEREIKAAGLRSKQGVLLGRKDGALLCFGGSEHVLVYAP
TRAGKGVGYVIPNLLNWPDSVVVLDVKKENWDRSAGFRAAHGQEVYLFDPLEEHGCTARYNPLGYVRSDP
ADLYDDLQRIAVMLFPAETRGDPFWFEAARSAFVAIGGYVAETPGLSLTIGEILHQLSAAPDLKAHFEKI
IAARKFGSSPLSRHCIAALNDFLAASENTMNSVRKTVTARLGLWLNPRIDAATTTNDFDLRHLRQKPMSI
YLGVTPDNLDRMAPLLNLFFQQVVDLNTRELPEQNPKLNRKVLLLLDEFPALGNVNVLARSVAFIAGYGI
RLLTVIQSPAQLRGIYGIDTARNFMTNHAVEVVFAPKEQDVANELSERIGYDTVKARSRSGPKGLAMRST
SETISEHRRALMLPQELKLLPKTKAFILGTGIPPIIADKIVYYEDKAFLRRLLPAPTPEMPNGRSNALLD
AEIKELRSAVAELRAAFRSRPMTDEEVADPSTIPADASFDFGDVDVDLEGLSEDDMKAWVLNYIDAQAIP
PSRRTGRKQKGEGHERRA
 
Nucleotide Sequence: 1947 bp     [Download]
>gi|148240870|ref|NC_009475.1|:c181021-179075 Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence
ATGACCCCGCTCGCAAACGCGACCACCTCAGTTAGGACAGCGCAGGGCCTCGCGGTCGCGCTCGCTGCTT
GCGCGGTATTCCTATTGGTCGCCTCAAACGTCCTGCTGCTGGGGCTCAGGCTTCACGATGGTGGCCTGCA
CTGGTCAGAGATCGCCACCGGCTGGTCCCGCTACGGCGCTGACCCACGTTTCGACCGCTGGCTAACCCTG
TCAACACTCGTCGGCGTGGTCGTCGTTTTCGGCCTGCTCGGTGCTATCTTTCGGCACCGTCCTTCCCCAC
TTCACGGCAGCGCGCGTTTCGCCTCCGAGCGGGAGATCAAGGCCGCTGGCCTGCGATCTAAGCAAGGCGT
GCTACTTGGACGAAAGGACGGTGCACTGCTCTGCTTCGGCGGATCGGAACACGTCCTGGTCTACGCTCCG
ACTAGGGCAGGGAAGGGGGTCGGCTACGTCATTCCGAACCTGCTGAATTGGCCAGATTCGGTGGTCGTTC
TGGATGTGAAGAAGGAAAACTGGGATCGCTCCGCAGGATTTCGCGCAGCCCACGGGCAGGAGGTCTATCT
GTTCGATCCGCTAGAGGAACACGGTTGCACCGCACGCTACAATCCGCTTGGCTACGTGCGCAGCGATCCC
GCGGACCTCTATGACGATCTGCAGCGCATCGCCGTCATGCTGTTTCCGGCCGAGACCCGGGGCGATCCGT
TCTGGTTCGAGGCAGCACGCTCGGCCTTCGTGGCGATTGGCGGCTATGTCGCGGAAACGCCGGGATTGTC
ATTGACGATCGGCGAGATCCTGCACCAGCTGTCCGCTGCCCCCGATCTCAAGGCACATTTTGAGAAGATC
ATCGCCGCTCGCAAGTTTGGCTCTTCGCCATTGTCGCGGCATTGCATTGCCGCATTGAATGATTTCCTCG
CCGCGTCCGAAAACACGATGAACTCGGTGCGTAAGACCGTCACGGCAAGGCTTGGTCTCTGGCTCAACCC
TCGGATCGATGCTGCGACAACGACCAACGATTTCGATCTGCGGCACCTGCGGCAAAAGCCGATGTCGATC
TATCTCGGCGTGACGCCTGACAATCTCGACCGCATGGCGCCACTTCTGAATCTGTTTTTCCAGCAGGTGG
TCGATCTCAATACCCGCGAGCTGCCGGAACAGAACCCCAAGCTCAATCGCAAGGTGCTGCTTTTGCTGGA
TGAATTTCCGGCGCTCGGCAATGTCAACGTGCTGGCGAGATCAGTGGCATTCATTGCCGGTTATGGCATC
CGCCTGCTGACCGTGATTCAGAGTCCGGCCCAGCTACGCGGAATCTACGGAATTGACACAGCCCGCAACT
TCATGACCAACCACGCCGTCGAGGTGGTCTTTGCGCCGAAGGAACAGGATGTCGCCAATGAGCTTTCGGA
GCGGATCGGTTACGACACCGTGAAAGCGCGCAGCCGCAGCGGACCGAAAGGACTGGCGATGCGCTCGACC
AGCGAAACGATTTCTGAACACCGCCGCGCCCTGATGCTGCCGCAGGAGCTGAAGCTACTTCCGAAAACCA
AGGCATTCATTCTCGGCACCGGCATTCCGCCCATTATCGCTGACAAGATCGTCTATTACGAAGACAAGGC
TTTCCTGCGGCGTCTGTTGCCTGCGCCTACCCCCGAAATGCCCAACGGTCGCTCGAATGCGTTGCTCGAC
GCCGAGATCAAAGAGCTTCGCTCCGCGGTCGCTGAGCTCCGGGCGGCATTTCGGTCTCGCCCGATGACCG
ACGAGGAGGTGGCCGATCCCTCCACAATCCCCGCCGACGCCTCCTTCGATTTTGGGGATGTGGACGTCGA
TCTCGAAGGGCTCTCGGAAGACGATATGAAAGCCTGGGTCCTGAATTACATCGACGCTCAAGCCATTCCG
CCGTCGCGGCGGACCGGCCGCAAGCAGAAGGGTGAGGGCCATGAACGACGGGCATAA
 Primer design