SecReT4
Protein ID: 148241056
T4SS name [ID]VirB [192]
Gene symbolavhB11
Locus tagBBta_p0248
StrainBradyrhizobium sp. BTAi1
Repliconplasmid pBBta01 [GenBank: NC_009475] [Browse all T4SS(s) in this replicon]
Location [Strand]180987..182018 [-]
ProductType IV secretory pathway AvhB11 protein
Component typeVirB11
UniProt IDA5EUP1
KEGG IDbbt:BBta_p0248
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-76, Aligned region: 21..322
Protein Sequence: 343 a.a.     [Download]
>gi|148241056|ref|YP_001220557.1| Type IV secretory pathway AvhB11 protein [Bradyrhizobium sp. BTAi1]
MSAVHSIERDGSRLVLARYLEPLAPFLADKSLTEIVVNRPGEIFVEGPGGWTRHEAPALTHAYLSHLATA
AAGHTRQDISPEHPVVSTTLIGEERCQIVVPPAVPAGMVSLTIRKPSALTMTLEAFERAKLFDEVRVAND
RLTADETQLLALKEAGAWRDFLQLAVETRRNIIVSGATGSGKTTLSKALIAAIPAQERLITIEDTAELVI
PHQNCVRLLYAKDGQGVAKIGPRELLESCLRMRPDRILLQELRDGTAFFYLRNVNSGHPGSITTVHADSA
RLAFEQLTLLVKESAEGRDLHRDDIRSLLLLLVDVVIQMQKRNGRYRISEIYYDPARKRDHLS
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|148240870|ref|NC_009475.1|:c182018-180987 Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence
GTGAGTGCGGTACACTCCATCGAACGCGACGGCAGTCGGCTCGTGCTGGCGCGCTACCTGGAGCCGCTGG
CTCCATTCCTGGCGGACAAGTCCCTGACCGAAATCGTCGTCAATCGTCCTGGCGAAATTTTCGTGGAAGG
TCCTGGCGGCTGGACCCGGCACGAAGCGCCAGCACTGACGCATGCCTACCTCTCACACCTCGCAACCGCG
GCCGCCGGCCACACCCGTCAGGACATCAGTCCGGAGCATCCCGTGGTGTCGACGACTCTGATCGGGGAGG
AGCGCTGCCAGATCGTGGTCCCACCAGCCGTGCCAGCCGGCATGGTCAGTCTTACGATCCGCAAGCCGTC
GGCTTTGACAATGACACTGGAGGCCTTCGAGCGCGCAAAACTGTTTGATGAGGTCCGTGTCGCCAATGAC
CGATTAACTGCCGATGAGACTCAGCTTCTGGCCCTGAAAGAAGCCGGTGCCTGGCGCGACTTCCTCCAGC
TTGCCGTGGAAACTCGTCGCAACATCATCGTTTCCGGGGCGACTGGTTCGGGAAAGACGACGCTATCCAA
GGCGTTGATCGCGGCGATCCCGGCTCAAGAGCGGCTCATTACAATTGAGGATACCGCCGAGCTTGTCATC
CCTCATCAGAATTGCGTGCGGCTGCTCTATGCCAAGGACGGGCAGGGCGTTGCTAAAATTGGACCGCGCG
AGCTCCTCGAGTCCTGCCTGAGGATGCGGCCGGATCGCATTCTGTTGCAAGAGCTGCGCGATGGGACCGC
ATTCTTCTATCTGAGGAATGTGAACTCGGGCCATCCGGGATCGATCACGACCGTTCATGCCGACAGTGCC
CGGCTCGCCTTCGAGCAGCTGACGTTGTTGGTGAAGGAAAGCGCGGAAGGCCGAGACCTTCATCGCGACG
ACATCCGCTCGCTCCTGCTGCTCCTCGTCGACGTCGTCATCCAGATGCAGAAGCGGAACGGCCGCTACCG
CATTTCGGAGATATATTATGACCCCGCTCGCAAACGCGACCACCTCAGTTAG
 Primer design