SecReT4
Protein ID: 148241059
T4SS name [ID]VirB [192]
Gene symbolavhB8
Locus tagBBta_p0251
StrainBradyrhizobium sp. BTAi1
Repliconplasmid pBBta01 [GenBank: NC_009475] [Browse all T4SS(s) in this replicon]
Location [Strand]184020..184691 [-]
ProductType IV secretory pathway AvhB8 protein
Component typeVirB8
UniProt IDA5EUP4
KEGG IDbbt:BBta_p0251
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.7e-66, Aligned region: 14..220
Protein Sequence: 223 a.a.     [Download]
>gi|148241059|ref|YP_001220560.1| Type IV secretory pathway AvhB8 protein [Bradyrhizobium sp. BTAi1]
MVGHDDLKAYFDNARRWEQDLLLAAHRSRRTAWVIAAGACALAIASLSAVAALAPLKTVEPFVIRVDNAT
GIVDTVSALTSTPARYDEAVTKYFLGRYVRAREGYSYPEAETNFRTISLLSGQGEQARFAAWYRGSNPES
PQVVQGRFGVATVRIKAISLLADNVASVRFMKESRKGEETRITHWVSTLTFSYTNAPMSSADRLINPLGF
VVSEYRADPEVVP
 
Nucleotide Sequence: 672 bp     [Download]
>gi|148240870|ref|NC_009475.1|:c184691-184020 Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence
ATGGTCGGTCACGATGACCTGAAAGCCTATTTCGACAATGCGCGTCGATGGGAGCAGGATCTGCTGCTGG
CGGCCCATCGCTCGCGCAGAACGGCATGGGTGATTGCCGCGGGTGCCTGCGCATTAGCGATCGCCTCACT
GAGTGCGGTCGCAGCGCTGGCGCCGCTGAAGACGGTCGAACCGTTCGTCATCCGGGTCGATAACGCGACC
GGGATTGTGGACACCGTCTCCGCCCTCACTTCGACGCCGGCGCGCTATGATGAAGCGGTCACCAAGTATT
TTCTTGGCCGCTACGTTCGCGCGCGCGAAGGCTACAGCTATCCGGAAGCCGAAACCAACTTCCGGACGAT
TTCGCTGCTCTCGGGGCAGGGCGAACAGGCCCGTTTTGCGGCCTGGTATCGCGGCTCCAATCCGGAAAGC
CCGCAAGTCGTTCAGGGCCGTTTCGGGGTCGCCACAGTACGGATCAAGGCGATCTCGCTCCTAGCTGACA
ATGTCGCCTCGGTGCGTTTCATGAAAGAGAGCCGCAAGGGCGAGGAAACCCGCATCACCCACTGGGTCTC
CACCCTGACGTTCTCCTATACCAACGCGCCAATGTCCTCCGCCGACCGTCTTATCAATCCGCTCGGCTTT
GTGGTCTCGGAATATCGCGCCGATCCGGAGGTCGTGCCATGA
 Primer design