SecReT4
Protein ID: 148241060
T4SS name [ID]VirB [192]
Gene symbolavhB7
Locus tagBBta_p0296
StrainBradyrhizobium sp. BTAi1
Repliconplasmid pBBta01 [GenBank: NC_009475] [Browse all T4SS(s) in this replicon]
Location [Strand]184693..184992 [-]
Productputative Type Four secretion pathway protein AvhB7
Component typeVirB7
UniProt IDA5EUP5
KEGG IDbbt:BBta_p0296
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 99 a.a.     [Download]
>gi|148241060|ref|YP_001220561.1| putative Type Four secretion pathway protein AvhB7 [Bradyrhizobium sp. BTAi1]
MWRRLFIICMIAIQLGGCASWSKGPPSCDGQARRPLNRSLWDWETGTPLATPEPAPPPSAPAPVIRKGET
SPAAPSTRLAASDHQAAIAASYRPCGKEA
 
Nucleotide Sequence: 300 bp     [Download]
>gi|148240870|ref|NC_009475.1|:c184992-184693 Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence
ATGTGGCGTCGACTATTCATTATTTGCATGATCGCAATTCAGCTTGGCGGCTGCGCAAGCTGGTCAAAGG
GACCGCCATCTTGTGATGGCCAGGCTCGGCGGCCGCTCAATCGTTCGCTGTGGGATTGGGAGACAGGTAC
GCCATTGGCGACACCGGAGCCGGCACCTCCGCCATCCGCGCCGGCACCAGTCATCCGCAAAGGCGAGACC
AGCCCGGCAGCGCCCTCCACGCGATTGGCTGCATCAGACCACCAGGCCGCCATTGCAGCCTCTTACCGGC
CTTGCGGCAAGGAGGCGTGA
 Primer design