SecReT4
Protein ID: 148244030
T4SS name [ID]VirB [24]
Gene symbol-
Locus tagAcry_3526
StrainAcidiphilium cryptum JF-5
Repliconplasmid pACRY03 [GenBank: NC_009469] [Browse all T4SS(s) in this replicon]
Location [Strand]57795..58496 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDA5FU44
KEGG IDacr:Acry_3526
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-50, Aligned region: 24..231
Protein Sequence: 233 a.a.     [Download]
>gi|148244030|ref|YP_001220268.1| VirB8 family protein [Acidiphilium cryptum JF-5]
MNADMKNTALPIDNERLAAYFQDVESFQATEKRTARRWGRVGWVVAGVSLAVNVTLAGAIVMILPLEKLV
PAFIIVKSDGTTSTTMNFNSLPSDEKAAMTRAAIWQYVRARESYDFADAQYRYDVASLMSNPTVQGTYQS
WFLDKGPGSTSPQVTVGKKGQISVAMVSMSMVRPNVALVRFRRTVTMYGSVPQTSTWTATVGFENVATLP
VSARLADPSGLIVTNYQAQKDSP
 
Nucleotide Sequence: 702 bp     [Download]
>ref|NC_009469.1|:57795-58496 VirB8 family protein [Acidiphilium cryptum JF-5]
ATGAACGCGGACATGAAAAACACGGCTTTGCCGATCGATAACGAACGGCTCGCCGCTTATTTCCAGGATG
TCGAATCTTTCCAGGCCACTGAGAAGCGCACAGCCCGCCGTTGGGGCCGTGTGGGCTGGGTGGTGGCCGG
CGTGTCCCTGGCGGTCAACGTGACCCTCGCGGGGGCGATCGTGATGATCCTGCCCCTCGAAAAGCTCGTG
CCCGCCTTCATCATCGTGAAGTCAGACGGCACCACCAGCACCACCATGAATTTCAACAGCCTTCCCAGCG
ATGAGAAGGCGGCGATGACCAGGGCCGCGATCTGGCAATATGTCCGTGCCCGGGAAAGCTATGACTTCGC
CGACGCGCAATATCGGTATGATGTTGCCTCGTTGATGTCCAACCCCACGGTGCAAGGCACCTACCAAAGC
TGGTTCCTCGATAAAGGGCCAGGCAGCACCAGCCCGCAGGTCACGGTTGGTAAAAAGGGGCAGATCAGCG
TCGCGATGGTGAGCATGTCCATGGTGCGGCCGAATGTCGCGCTCGTGCGCTTCCGCCGCACCGTGACGAT
GTACGGCTCAGTTCCGCAGACTTCGACATGGACGGCAACGGTCGGCTTTGAAAACGTCGCAACCCTGCCG
GTTTCAGCCCGCCTCGCAGACCCCAGCGGGCTCATTGTGACCAACTACCAGGCCCAAAAGGATTCGCCAT
GA
 Primer design