SecReT4
Protein ID: 148244034
T4SS name [ID]VirB [24]
Gene symbol-
Locus tagAcry_3530
StrainAcidiphilium cryptum JF-5
Repliconplasmid pACRY03 [GenBank: NC_009469] [Browse all T4SS(s) in this replicon]
Location [Strand]60823..61890 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDA5FU48
KEGG IDacr:Acry_3530
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.6e-60, Aligned region: 25..321
Protein Sequence: 355 a.a.     [Download]
>gi|148244034|ref|YP_001220272.1| type II secretion system protein E [Acidiphilium cryptum JF-5]
MNGTDFSDDLVAESPAAPLLRFLLAPLQPWLNDGATEELCINRPGECWVRQRGVFERFKVPLDRSALEDI
AVLAGALRRQDVGPTSPLCSTELPGGERLQICLPPAVPTGTVSLTIRRPGSTVAPLSSVTSRYQSDGWNS
WAENRDTRNFAEALDYYDSGDLEGFLAAAVRCRMTILLCGATGSGKTTMSKTLISAIPMAERIITIEDTA
ELVIPQPNHVRLLYSKDGLSTAKIDAEALLQASLRMRPDRVLLQELRDDAAWTYVNEVVSGHPGSITTIH
GANPAQAFKKLFSLIKGSPKGASFDDATLCDLLAAAVDLIIPFETSGTTYRIGKVWFGPDATRRGETAAA
LLRAA
 
Nucleotide Sequence: 1068 bp     [Download]
>ref|NC_009469.1|:60823-61890 type II secretion system protein E [Acidiphilium cryptum JF-5]
ATGAACGGCACCGATTTTTCCGATGACCTCGTGGCGGAAAGCCCGGCCGCGCCGCTGCTCCGCTTCCTGC
TCGCCCCGCTGCAACCCTGGCTGAACGATGGGGCCACTGAGGAGCTGTGCATCAACCGGCCCGGCGAGTG
CTGGGTGCGCCAGCGCGGCGTTTTTGAGCGGTTCAAGGTGCCCCTCGATCGCTCGGCGCTGGAGGATATT
GCCGTGCTCGCCGGCGCGCTGCGCCGTCAGGATGTCGGCCCTACCTCGCCGCTTTGCTCCACCGAACTGC
CAGGCGGCGAACGGCTGCAAATCTGCCTGCCGCCGGCCGTGCCCACCGGTACGGTCAGCCTGACAATCCG
CCGGCCGGGCTCGACGGTCGCGCCGCTCTCCTCCGTCACCTCCAGGTATCAGTCGGACGGATGGAACAGT
TGGGCGGAAAACCGGGACACCCGGAATTTCGCGGAAGCCCTGGACTACTACGATTCCGGCGATCTTGAGG
GCTTCCTTGCGGCGGCCGTGCGCTGCCGCATGACCATCCTGCTCTGTGGCGCCACCGGCTCCGGCAAAAC
CACGATGAGCAAAACGCTGATCTCGGCGATCCCCATGGCAGAGCGGATCATCACGATCGAGGACACGGCG
GAGCTTGTGATCCCGCAACCGAATCATGTCCGGCTGCTCTACTCGAAAGACGGCCTCTCCACCGCGAAAA
TCGACGCCGAGGCGCTGCTGCAGGCCAGCCTGCGCATGCGGCCAGATCGGGTGCTCCTGCAAGAGCTCCG
CGACGATGCGGCATGGACCTATGTGAACGAGGTGGTTTCCGGGCATCCGGGCTCGATCACCACCATTCAC
GGCGCCAACCCGGCCCAGGCGTTCAAGAAGCTGTTTTCGCTCATCAAGGGATCCCCGAAGGGCGCTAGCT
TCGATGACGCCACGCTTTGCGATCTGCTTGCGGCGGCTGTCGATCTCATCATCCCGTTCGAGACTTCCGG
CACCACCTACCGGATCGGCAAGGTCTGGTTTGGCCCGGACGCGACCAGGCGCGGCGAAACAGCCGCCGCC
CTCTTGCGGGCCGCCTGA
 Primer design