SecReT4
Protein ID: 148244035
T4SS name [ID]VirB [24]
Gene symbol-
Locus tagAcry_3531
StrainAcidiphilium cryptum JF-5
Repliconplasmid pACRY03 [GenBank: NC_009469] [Browse all T4SS(s) in this replicon]
Location [Strand]61890..63710 [+]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDA5FU49
KEGG IDacr:Acry_3531
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.9e-81, Aligned region: 137..604
TraG-D_C [PF12696], Evalue: 4.9e-24, Aligned region: 435..562
TrwB_AAD_bind [PF10412], Evalue: 5.4e-14, Aligned region: 182..571
Protein Sequence: 606 a.a.     [Download]
>gi|148244035|ref|YP_001220273.1| TRAG family protein [Acidiphilium cryptum JF-5]
MTWRGVMRLLVGLVLGLVFFSVLATMIFLIGTGLFWHFRHPFWQWWLYLFEASGDPTVRVWLVISGVPAF
AIPFLAGVVQLVRGRRVTGWSLRRDHAPTKPVDAPIRAPTDNHGHARWMTMEEARARFPGPAPEYGGLVV
GEAYEVHRDSVASMPFRPKDRSTWGQGGKAPLLIDPCEIGSTHCMMFAGSGGYKTTTAVSTLLTWTGSAI
VLDPSVELGPMLRQAREDMGHKVYMLDPRTAREVGFNVLDWVDVSSPLAEIDVQAVVEWVCGDTKAGGDE
NASFFKNSGKELVTALLAHMLWDEHLEPHEKTLRAVRAAIVTPEKELRNVLAHIHKNSQSRLARDLAGSL
KDIVDETFSGIYKNATQDTAWLSTAAYADLVSGNAFRCAELTLGKTTVFINIPLKALDATPAVARVITGA
LLNAAYEADGVIEGRVLFLLDEAARLGPMKILETARDCARKYKITLFPFYQSIGQLRELFGQNGPAKWFE
SVSWYGFAGVKTKAVAEELAAAIGEYGVLAWSEGSNTGNSAKGLEAGTRSTGQTKTYHELKRQLIRAEEI
MHDMRDDEQIIFPKSGRPLRCGRAIYFRRPEMAARVGENRFAVNAT
 
Nucleotide Sequence: 1821 bp     [Download]
>ref|NC_009469.1|:61890-63710 TRAG family protein [Acidiphilium cryptum JF-5]
ATGACCTGGCGCGGCGTGATGCGGCTCCTCGTTGGGCTGGTGCTCGGCCTGGTGTTCTTCTCCGTCCTCG
CCACGATGATCTTCCTCATTGGAACCGGACTGTTCTGGCATTTCCGGCATCCGTTCTGGCAATGGTGGCT
CTATCTTTTCGAGGCCAGCGGAGATCCTACTGTACGGGTCTGGCTGGTCATCAGCGGCGTGCCGGCCTTC
GCGATCCCCTTCCTCGCCGGGGTCGTTCAGCTTGTGCGCGGCCGGCGCGTCACCGGCTGGTCACTGCGCC
GCGATCACGCCCCGACAAAGCCCGTCGATGCGCCGATCCGTGCCCCAACCGACAACCATGGTCATGCCCG
CTGGATGACGATGGAGGAGGCCCGCGCCAGGTTCCCGGGGCCAGCCCCGGAATATGGCGGGCTTGTCGTG
GGCGAAGCGTATGAGGTTCACCGCGACAGCGTTGCCAGTATGCCGTTCAGGCCGAAGGATCGTTCAACCT
GGGGGCAGGGGGGCAAGGCGCCCCTGCTGATCGATCCATGCGAGATTGGCTCGACCCATTGCATGATGTT
CGCCGGATCGGGCGGCTACAAGACGACGACGGCCGTCTCCACGCTGCTGACATGGACCGGCTCGGCCATT
GTCCTTGACCCCTCGGTGGAGCTGGGGCCGATGTTGCGCCAGGCGCGTGAGGACATGGGCCACAAGGTCT
ATATGCTCGATCCCCGCACGGCCCGCGAAGTCGGGTTCAATGTGCTCGACTGGGTCGATGTCTCCTCCCC
CCTCGCGGAAATCGATGTTCAGGCCGTGGTTGAGTGGGTTTGCGGCGATACCAAAGCAGGCGGCGATGAA
AACGCCTCCTTCTTCAAGAACAGCGGCAAGGAGCTGGTGACGGCGCTGCTCGCGCATATGCTCTGGGACG
AACACCTGGAACCGCACGAAAAGACCTTGCGCGCCGTCCGCGCGGCCATCGTTACGCCCGAAAAGGAGCT
GCGGAACGTCTTGGCCCATATTCACAAGAACTCGCAAAGCCGCCTCGCCCGCGATCTGGCCGGTAGCTTG
AAGGACATTGTGGATGAGACCTTTAGCGGCATCTACAAGAACGCCACCCAGGACACGGCCTGGCTTTCAA
CCGCCGCCTATGCGGATCTCGTCTCCGGCAATGCGTTCCGTTGCGCTGAGCTGACGCTCGGCAAGACCAC
GGTTTTCATCAACATTCCCCTCAAGGCGCTCGATGCCACCCCGGCCGTCGCCCGCGTCATCACCGGCGCG
CTGCTGAACGCGGCCTATGAAGCGGATGGCGTGATCGAAGGCCGCGTGTTGTTCCTGCTCGATGAGGCCG
CCCGGCTTGGCCCCATGAAAATCCTCGAAACCGCCCGCGACTGCGCCCGGAAATACAAGATCACGCTGTT
TCCGTTTTATCAGTCGATCGGCCAGCTTCGCGAGCTGTTCGGCCAGAACGGCCCGGCCAAGTGGTTTGAA
TCGGTCAGCTGGTATGGCTTCGCCGGCGTCAAAACCAAGGCCGTTGCCGAGGAGCTGGCTGCGGCGATCG
GCGAATATGGCGTGCTGGCCTGGTCGGAAGGCTCGAACACCGGCAACTCGGCAAAGGGCCTGGAAGCAGG
CACGCGCTCGACCGGCCAGACCAAAACCTATCATGAGCTGAAACGCCAACTCATCCGGGCCGAGGAAATC
ATGCACGACATGAGGGATGATGAGCAGATCATCTTCCCAAAATCCGGCCGGCCGCTGCGCTGCGGCCGGG
CCATTTATTTTCGGCGGCCTGAGATGGCCGCACGTGTGGGCGAGAACCGCTTTGCCGTCAACGCAACTTA
A
 Primer design