SecReT4
Protein ID: 148253041
T4SS name [ID]Trb [335]
Gene symboltrbC
Locus tagBBta_1501
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]1589051..1589377 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA5EC26
KEGG IDbbt:BBta_1501
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.3e-22, Aligned region: 8..98
Protein Sequence: 108 a.a.     [Download]
>gi|148253041|ref|YP_001237626.1| conjugal transfer protein TrbC [Bradyrhizobium sp. BTAi1]
MKFNQSGMRGIVGAAAFAITYLTITSASAAGSNMPWEQPLNQILQSVEGPVAKIVGVIIIIVTGLSLALG
DTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFGGGVVI
 
Nucleotide Sequence: 327 bp     [Download]
>gi|148251626|ref|NC_009485.1|:1589051-1589377 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGAAGTTCAATCAATCGGGCATGCGAGGGATTGTAGGGGCGGCCGCGTTCGCAATCACCTACCTTACCA
TCACTTCAGCATCGGCTGCCGGCTCCAACATGCCGTGGGAGCAACCGCTCAACCAGATCCTGCAATCGGT
TGAGGGCCCCGTCGCCAAGATCGTCGGCGTCATCATCATCATCGTCACCGGACTCTCGCTCGCGCTAGGC
GATACGTCCGGGGGCTTCCGCAAGTTGATCCAGATTGTGTTCGGCCTGTCGATCGCGTTTGCGGCCTCGA
GTTTCTTCCTGTCGTTTTTTTCATTCGGCGGGGGAGTTGTGATCTGA
 Primer design