SecReT4
Protein ID: 148253045
T4SS name [ID]Trb [335]
Gene symbol-
Locus tagBBta_1505
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]1593199..1594404 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5EC30
KEGG IDbbt:BBta_1505
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-52, Aligned region: 38..262
Protein Sequence: 401 a.a.     [Download]
>gi|148253045|ref|YP_001237630.1| conjugal transfer protein TrbL [Bradyrhizobium sp. BTAi1]
MGGTGIIDQFLETFTRYIDSGFGLLGGEVGYLATTLAAIDVTLAGLFWAWGADEDILARVVKKTLFVGVF
AFLIGNWSSLARIVFESFAGLGLKASGTGLSTADFLRPGKIAQVGLDAGRPILDSISGLMGYVSFFENFV
QISVLLFAWIVVLLAFFILAIQLFITLIEFKLTTLAGFVLIPFGLFGKTDFAAERVLGNVISSGVKVLVL
AVIVGIGSTLFTQFTAGFGGNQPTIDNAMALVLGALALLGLGIFGPGIANGIVSGGPQLGAGAAVGTGLA
AGGAVVAGAGLATGGVGMAGGALLGGARGVASVASGATSAYRAGGLSGVASAGGSAIVSPLRRMAASFAS
SSSTSDAAPAWARRMKRAQTVNQGASAATHAVRSGDSAGSGASVDLSEGGH
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|148251626|ref|NC_009485.1|:1593199-1594404 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGGGTGGCACGGGAATCATTGATCAGTTTCTGGAGACGTTCACCCGGTACATCGATTCCGGGTTTGGCC
TGCTCGGGGGCGAAGTCGGATATCTTGCCACGACGCTCGCGGCAATCGACGTCACGCTTGCCGGCCTATT
CTGGGCATGGGGGGCGGATGAGGACATTCTGGCCCGGGTCGTCAAGAAGACCTTGTTTGTCGGCGTCTTC
GCGTTCCTGATCGGCAATTGGAGCAGCCTCGCACGCATCGTCTTCGAGAGCTTTGCCGGCTTGGGGCTGA
AAGCTTCCGGCACTGGCCTTTCCACGGCCGACTTCTTGCGGCCAGGAAAGATTGCTCAGGTTGGGCTCGA
TGCCGGACGACCGATTCTCGATTCGATCTCAGGGCTGATGGGCTATGTCAGCTTCTTCGAGAACTTCGTC
CAGATCTCGGTGCTGTTGTTTGCCTGGATCGTGGTGCTGCTGGCGTTCTTTATTCTGGCCATCCAGCTCT
TCATCACCCTCATCGAGTTCAAGCTGACGACGCTCGCGGGCTTCGTGCTGATCCCATTCGGTCTGTTCGG
CAAGACCGACTTTGCCGCCGAGCGCGTGCTGGGCAACGTGATTTCGTCGGGCGTCAAGGTTCTGGTGCTG
GCCGTCATCGTCGGTATCGGGTCGACGCTGTTTACCCAGTTCACGGCCGGTTTTGGTGGCAATCAGCCGA
CCATCGATAACGCCATGGCGCTCGTGCTCGGAGCCCTTGCCCTTCTGGGCCTTGGCATCTTTGGACCGGG
AATTGCCAACGGCATCGTGTCGGGCGGACCACAGCTCGGTGCCGGCGCCGCAGTCGGCACCGGCTTGGCC
GCAGGCGGTGCCGTCGTTGCGGGCGCGGGTCTTGCCACCGGTGGTGTCGGAATGGCCGGCGGCGCGCTGC
TGGGCGGAGCCCGTGGGGTCGCCTCGGTTGCGAGCGGGGCAACCAGTGCCTACCGAGCCGGAGGACTGTC
GGGTGTCGCGAGCGCAGGCGGCTCGGCGATTGTCAGCCCGCTGCGCCGTATGGCTGCGAGCTTCGCAAGC
AGCTCGTCAACGAGTGATGCAGCACCGGCCTGGGCGCGCCGGATGAAACGTGCGCAGACGGTCAATCAAG
GGGCATCCGCTGCCACTCATGCTGTCCGCAGTGGTGATAGCGCAGGTAGCGGGGCTTCCGTTGATCTGTC
CGAGGGAGGACACTGA
 Primer design