SecReT4
Protein ID: 148253047
T4SS name [ID]Trb [335]
Gene symboltrbG
Locus tagBBta_1507
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]1595084..1596067 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA5EC32
KEGG IDbbt:BBta_1507
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.2e-65, Aligned region: 106..321
Protein Sequence: 327 a.a.     [Download]
>gi|148253047|ref|YP_001237632.1| conjugal transfer protein TrbG [Bradyrhizobium sp. BTAi1]
MRKPAPLSVGLKRNSGPVGLVVLVTAALSGCTTFKPPQVSYDNDLQSSPDLPMAADERARPLHVPPPWTP
TRGGKKGDEEANEPADRIATANDAARVEPRRAGYFNAVQVFPYSPGALYQIYASPGQITDIALEPGEQLT
GSGPLAAGDTVRWIVGDTESGNGDTRRVHIMVKPTRTAIETNLVVNTDRRTYLIELRSRERPYMPSVAWF
YPEDRRDRSKALPPTPLIPAIDQRRYRYVVEGDNPPWRPVNAYDDGRKVYIEFSPGIAQGEMPPLFVVGQ
DGKPELVNYRVYKNILIADRLFAAAELRLGGEKQQIVRIARNDGGRS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|148251626|ref|NC_009485.1|:1595084-1596067 Bradyrhizobium sp. BTAi1 chromosome, complete genome
GTGAGAAAGCCTGCACCGTTGTCGGTTGGTCTGAAGCGCAATAGCGGCCCCGTTGGTCTCGTCGTTCTCG
TAACGGCCGCGCTCTCCGGCTGCACAACGTTCAAGCCCCCGCAGGTCAGCTATGATAACGACCTACAATC
GTCCCCCGATCTCCCAATGGCGGCGGACGAACGCGCGCGCCCGCTGCACGTCCCGCCGCCCTGGACACCA
ACCCGCGGCGGTAAGAAGGGCGATGAGGAGGCCAACGAGCCGGCGGACCGGATCGCGACGGCCAATGATG
CCGCGCGGGTCGAGCCGCGGCGGGCAGGGTACTTCAACGCCGTCCAGGTGTTTCCTTACAGCCCCGGCGC
GCTCTATCAGATCTATGCCTCGCCCGGCCAGATTACCGATATCGCGCTCGAGCCGGGCGAGCAGCTGACC
GGTTCGGGACCACTTGCCGCCGGCGACACCGTACGCTGGATCGTCGGCGATACCGAAAGCGGCAACGGAG
ATACCAGGCGCGTCCACATCATGGTCAAGCCGACGCGGACCGCTATCGAGACAAATCTCGTCGTCAACAC
CGACCGGCGGACTTACCTCATCGAGCTGCGCTCCCGCGAAAGGCCATACATGCCGTCGGTCGCCTGGTTT
TACCCCGAAGACCGAAGGGACCGCTCCAAGGCTTTGCCCCCAACTCCGCTCATCCCGGCGATAGACCAGC
GCCGCTACCGCTACGTCGTTGAGGGCGACAACCCGCCCTGGCGGCCAGTCAATGCGTATGATGACGGCCG
AAAGGTCTATATCGAATTCTCGCCCGGGATCGCACAGGGCGAAATGCCGCCGCTGTTCGTCGTCGGCCAG
GACGGCAAACCGGAGCTCGTCAACTATCGCGTCTACAAAAATATCCTGATTGCCGACCGTCTGTTTGCCG
CGGCCGAACTGCGCCTTGGCGGAGAGAAGCAACAGATAGTGCGGATTGCGAGGAACGACGGAGGCCGATC
GTGA
 Primer design