SecReT4
Protein ID: 148254771
T4SS name [ID]Trb [336]
Gene symbol-
Locus tagBBta_3349
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3504553..3505068 [+]
Productconjugal transfer protein
Component typeTraF
UniProt IDA5EH06
KEGG IDbbt:BBta_3349
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.3e-49, Aligned region: 30..167
Protein Sequence: 171 a.a.     [Download]
>gi|148254771|ref|YP_001239356.1| conjugal transfer protein [Bradyrhizobium sp. BTAi1]
MTTDAVLRLALIGVAAIAVSAVPQSSTVRFVWNLSASVPTGLYRLRPSGDRSIGEIVAVQPPQPIADFLA
SRGYLPRGVPMMKHVAALPGQVVCRHGLAILIDAVEVGQAQERDSRGRPLPVWQGCRTLSKDEAFLMNTR
SAISLDGRYFGVLPVSAIVGHAEPLWVGGEE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3504553-3505068 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGACGACAGATGCTGTGCTTCGTCTTGCGCTCATCGGAGTGGCTGCCATCGCCGTGTCGGCCGTGCCGC
AGTCGTCGACCGTCCGCTTTGTCTGGAACCTCTCTGCAAGCGTCCCGACGGGCCTCTACCGGCTGCGCCC
CAGCGGCGATCGCTCCATTGGCGAGATCGTTGCGGTGCAGCCGCCGCAGCCGATCGCCGATTTCCTGGCG
AGCCGAGGCTACCTGCCGCGCGGCGTACCGATGATGAAGCATGTCGCGGCGCTGCCCGGGCAGGTCGTCT
GCAGGCACGGACTCGCGATTCTCATCGACGCGGTCGAGGTGGGGCAGGCGCAAGAGCGTGATAGCCGGGG
GCGGCCACTGCCGGTGTGGCAGGGCTGCCGAACGCTCAGCAAAGATGAAGCTTTTCTGATGAACACGCGC
TCGGCGATCTCCCTCGATGGGCGATATTTCGGCGTGCTGCCGGTGTCCGCCATCGTCGGTCACGCCGAGC
CGCTGTGGGTGGGTGGGGAGGAGTGA
 Primer design