SecReT4
Protein ID: 148254772
T4SS name [ID]Trb [336]
Gene symbol-
Locus tagBBta_3350
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3505071..3505901 [+]
Productlytic transglycosylase
Component typeTrbN
UniProt IDA5EH07
KEGG IDbbt:BBta_3350
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 276 a.a.     [Download]
>gi|148254772|ref|YP_001239357.1| lytic transglycosylase [Bradyrhizobium sp. BTAi1]
MHDGRRPFGARSIAQTSAGSFVAAASRVVATQVRRHGQSVIIAAVLAWSIVAGATAQASPSSSRLHVVST
SSVDTFAGSVSEAAHRFDIPERWIYAVMRAESGGDRRARSSKGAVGLMQIMPETWRDLRARYGLGADPFD
PHDNVLAGAAYLRELHDRYGSPGFLAAYNAGPGRYERHLATGRPLPDETRAYVAKLSSAVGGVQAQRPVD
VSRAAAFSLADLFAPRGSQRMADDHPSVTGKRSVRSLRVARRGNLSSLLPRPHALFARHAGGNLWR
 
Nucleotide Sequence: 831 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3505071-3505901 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGCACGACGGTCGCCGGCCCTTCGGTGCTCGTTCGATCGCTCAGACCTCCGCTGGCTCGTTCGTCGCGG
CCGCTTCTCGCGTCGTCGCTACGCAAGTCCGGAGGCACGGGCAGAGCGTTATCATCGCTGCAGTCCTCGC
ATGGTCGATTGTCGCCGGCGCGACAGCACAGGCCTCCCCGTCGTCCTCCCGTCTGCACGTCGTGAGCACG
TCCTCTGTTGACACATTTGCAGGTTCTGTGAGCGAAGCTGCGCATCGGTTCGATATTCCCGAGCGCTGGA
TCTATGCCGTCATGCGCGCTGAAAGCGGCGGTGATCGGCGGGCTCGCTCGTCAAAGGGCGCCGTCGGCCT
GATGCAGATCATGCCGGAGACCTGGCGCGATTTGCGCGCCCGCTACGGCCTTGGGGCTGATCCCTTCGAT
CCTCACGACAACGTTCTGGCGGGCGCAGCCTATCTTCGCGAGCTGCACGACCGTTATGGATCGCCTGGGT
TCCTCGCAGCCTACAATGCGGGTCCCGGGCGGTATGAACGTCATCTGGCAACGGGCCGGCCGCTGCCGGA
CGAAACCCGAGCCTACGTCGCGAAGCTTTCGTCCGCCGTCGGCGGTGTGCAAGCCCAACGGCCTGTCGAT
GTCTCCCGAGCGGCAGCGTTCTCGCTTGCGGATTTGTTCGCCCCGCGCGGTTCGCAACGCATGGCCGACG
ATCATCCGAGTGTAACTGGCAAGCGCTCGGTCAGATCATTGCGTGTCGCTCGCCGCGGCAATCTTTCGTC
GCTTCTACCGCGGCCGCATGCGTTGTTTGCTCGGCATGCCGGCGGAAATCTCTGGCGATGA
 Primer design